Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021499 [exp] 110 / 1e-33 ND / Lus10017210 [exp] 92 / 2e-26 ND / Lus10021100 [exp] 91 / 1e-25 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092300 [exp] 61 / 5e-14 ND / Potri.016G103900 [exp] 61 / 9e-14 ND / Potri.010G196500 [exp] 56 / 6e-12 ND / Potri.008G061600 [exp] 51 / 7e-10 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022600 pacid=23178599 polypeptide=Lus10022600 locus=Lus10022600.g ID=Lus10022600.BGIv1.0 annot-version=v1.0 ATGGGAAACCTGAGGAACTCTTTGCTTCTTCTGCTTCTAATACTCACTCTATCAGCCACCAACATATCCAAATCTGCAGAAGCAAGAACACTTCCCTTCT CATCTCTTCACCTACGATCTTCCAAGATATTTGCAACACTGGGAGTCGAATGCAAGTGCTGTGACAGCGGAGAATGTTCAAGCTCCTGGAAAGGGTCGTG CAGCGATGTCAAGTGTCTTCCCTGGAGAATTGGGTAG
AA sequence Show only first row Show all	>Lus10022600 pacid=23178599 polypeptide=Lus10022600 locus=Lus10022600.g ID=Lus10022600.BGIv1.0 annot-version=v1.0 MGNLRNSLLLLLLILTLSATNISKSAEARTLPFSSLHLRSSKIFATLGVECKCCDSGECSSSWKGSCSDVKCLPWRIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022600 [exp]	0	1
					Lus10021499 [exp]	1.0	0.9401
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10035184 [exp]	12.4	0.8619
AT4G14710		ATARD2	RmlC-like cupins superfamily p...		Lus10039375 [exp]	12.5	0.8657
AT5G15730		CRLK2, AtCRLK2	calcium/calmodulin-regulated r...		Lus10008540 [exp]	14.2	0.8689
AT3G09010			Protein kinase superfamily pro...		Lus10011193 [exp]	21.5	0.8370
AT2G19460			Protein of unknown function (D...		Lus10027629 [exp]	27.5	0.8638
AT4G38260			Protein of unknown function (D...		Lus10012253 [exp]	31.4	0.8325
AT4G37530			Peroxidase superfamily protein...		Lus10011079 [exp]	31.7	0.8278
AT3G16565			alanine-tRNA ligases;nucleic a...		Lus10000503 [exp]	32.2	0.8578
AT2G35795			Chaperone DnaJ-domain superfam...		Lus10041420 [exp]	33.0	0.8168

Compare expression of checked genes

Lus10022600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.