Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 177 / 7e-58 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 169 / 2e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 79 / 7e-19 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 77 / 4e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 75 / 3e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 73 / 1e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 73 / 4e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G68300 66 / 3e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G54430 64 / 7e-13 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017207 [exp] 288 / 1e-101 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 287 / 3e-101 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021501 [exp] 220 / 3e-75 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10037761 [exp] 170 / 1e-54 AT3G17020 224 / 4e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10016900 [exp] 172 / 2e-51 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 75 / 3e-17 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 66 / 4e-14 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10031594 [exp] 67 / 9e-14 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10006701 [exp] 65 / 1e-13 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092700 [exp] 235 / 2e-80 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.016G104600 [exp] 233 / 1e-79 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.004G075375 [exp] 185 / 1e-60 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.017G144301 [exp] 184 / 3e-60 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 177 / 1e-57 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 81 / 2e-19 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 77 / 5e-18 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.002G196700 [exp] 71 / 7e-16 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.011G039800 [exp] 71 / 3e-15 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.005G015200 [exp] 69 / 5e-15 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10022602 pacid=23178657 polypeptide=Lus10022602 locus=Lus10022602.g ID=Lus10022602.BGIv1.0 annot-version=v1.0 ATGGGGAAAGACAAGACGATTGGAGTAGCGATGGACTTCTCAGCGAGCAGCAAGAACGCTCTGAAATGGGCATTAGACAACTTAGCAGATAAGGGTGACA CCATCTACATCATCCATGTCAATCCCCATGAGCTCCCCGAAGGCAAAAATCAACTCTGGGGCACCGCCGGCTCTCCTTTGATCCCTCTTGCGGAGTTCAG GGAGAAGGAGGTTATGAAGACGTATGGATTGAAGCCCGATGCTGACGTTCTCGATCTGCTCGACACTACTTCCAGGCAGAAAGAGATCAAAGTAGTGACG AAGCTGTACTGGGGAGGAGACGCAAGGGAGAGGATCATTGATGCCATTGAAGGGTTGAAGCTTGACTCTGTTGTGATGGGAAGCAGAGGACTCGGCACTG TTAAGAGGATATTGATGGGAAGTGTGAGTTCGTATGTGATGAACGCGGCATCTTGCCCTGTCACCATTGTCAAGGAAGCATAA
AA sequence Show only first row Show all	>Lus10022602 pacid=23178657 polypeptide=Lus10022602 locus=Lus10022602.g ID=Lus10022602.BGIv1.0 annot-version=v1.0 MGKDKTIGVAMDFSASSKNALKWALDNLADKGDTIYIIHVNPHELPEGKNQLWGTAGSPLIPLAEFREKEVMKTYGLKPDADVLDLLDTTSRQKEIKVVT KLYWGGDARERIIDAIEGLKLDSVVMGSRGLGTVKRILMGSVSSYVMNAASCPVTIVKEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53990			Adenine nucleotide alpha hydro...		Lus10022602 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10006928 [exp]	1.4	0.9532
AT3G24020			Disease resistance-responsive ...		Lus10023689 [exp]	2.2	0.9576
AT2G20780		AtPLT4	Major facilitator superfamily ...		Lus10039812 [exp]	2.6	0.9474
AT1G71740			unknown protein		Lus10042773 [exp]	3.2	0.9505
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Lus10018986 [exp]	3.3	0.9420
AT1G67550		URE	urease (.1)		Lus10015814 [exp]	3.6	0.9410
AT5G05390		LAC12	laccase 12 (.1)		Lus10042252 [exp]	4.2	0.9482
AT3G14470			NB-ARC domain-containing disea...		Lus10042117 [exp]	4.5	0.9507
AT3G24020			Disease resistance-responsive ...		Lus10011767 [exp]	4.6	0.9519
AT3G11040		AtENGase85B	Endo-beta-N-acetyglucosaminida...		Lus10007526 [exp]	5.2	0.9269

Compare expression of checked genes

Lus10022602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.