Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53540 74 / 8e-18 HSP20-like chaperones superfamily protein (.1) AT1G59860 74 / 9e-18 HSP20-like chaperones superfamily protein (.1) AT1G07400 74 / 9e-18 HSP20-like chaperones superfamily protein (.1) AT2G29500 59 / 5e-12 HSP20-like chaperones superfamily protein (.1) AT4G10250 59 / 1e-11 ATHSP22.0 HSP20-like chaperones superfamily protein (.1) AT3G46230 57 / 1e-11 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1) AT5G59720 56 / 1e-10 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1) AT5G37670 49 / 2e-08 HSP15.7CI HSP20-like chaperones superfamily protein (.1) AT4G21870 45 / 5e-07 HSP20-like chaperones superfamily protein (.1) AT5G12030 42 / 8e-06 AT-HSP17.6A heat shock protein 17.6A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021503 [exp] 179 / 5e-60 AT1G07400 82 / 3e-21 HSP20-like chaperones superfamily protein (.1) Lus10042408 [exp] 63 / 3e-13 AT4G10250 154 / 1e-47 HSP20-like chaperones superfamily protein (.1) Lus10040830 [exp] 58 / 8e-12 AT1G53540 236 / 6e-81 HSP20-like chaperones superfamily protein (.1) Lus10009085 [exp] 58 / 1e-11 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1) Lus10016458 [exp] 57 / 2e-11 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1) Lus10016456 [exp] 57 / 2e-11 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1) Lus10016457 [exp] 57 / 2e-11 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1) Lus10040723 [exp] 57 / 2e-11 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1) Lus10040722 [exp] 57 / 3e-11 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G187450 [exp] 75 / 3e-18 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1) Potri.009G049900 [exp] 74 / 4e-18 AT2G29500 154 / 2e-48 HSP20-like chaperones superfamily protein (.1) Potri.009G049800 [exp] 74 / 5e-18 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1) Potri.019G081250 [exp] 74 / 6e-18 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1) Potri.009G039200 [exp] 74 / 7e-18 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1) Potri.009G147900 [exp] 73 / 2e-17 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1) Potri.009G148000 [exp] 73 / 2e-17 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1) Potri.004G187400 [exp] 72 / 3e-17 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1) Potri.006G093400 [exp] 67 / 2e-15 AT1G53540 112 / 5e-32 HSP20-like chaperones superfamily protein (.1) Potri.004G187202 [exp] 67 / 4e-15 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [flax] [poplar] HSP20 PF00011 [flax] [poplar] HSP20 Hsp20/alpha crystallin family
Representative CDS sequence Show only first row Show all	>Lus10022604 pacid=23178571 polypeptide=Lus10022604 locus=Lus10022604.g ID=Lus10022604.BGIv1.0 annot-version=v1.0 ATGGATTGGCAGGAGACCGCAGATGCACACGTGTTCAGAGCCCAGCTGTCTGGATTCAAAAAGGAGGAAGTGATGCTACAACTGGAAGAAGAAGGAGGGG GTACAGTGATTCGCATCAGCTGCGAGAAGGTGGTGGAGATCAAGGAAGAGAAGGAGAATGGATGGTACCATGTTGGTCGTAGCAGTGGGCTGAATCATCA GCTTGTGAGGCTGCCAGAGTCTGCAGATCCTAAGCATATGGAAGCTGGGATGGAGGATGGGGTGCTTACGATTACTATTCGGAAGAAGAGTTCAGGATTC GTCGATGTTTCTTAA
AA sequence Show only first row Show all	>Lus10022604 pacid=23178571 polypeptide=Lus10022604 locus=Lus10022604.g ID=Lus10022604.BGIv1.0 annot-version=v1.0 MDWQETADAHVFRAQLSGFKKEEVMLQLEEEGGGTVIRISCEKVVEIKEEKENGWYHVGRSSGLNHQLVRLPESADPKHMEAGMEDGVLTITIRKKSSGF VDVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07400			HSP20-like chaperones superfam...		Lus10022604 [exp]	0	1
AT3G48670		RDM12, IDN2	RNA-DIRECTED DNA METHYLATION 1...		Lus10002305 [exp]	2.0	0.9232
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10020191 [exp]	3.5	0.9389
AT1G73040			Mannose-binding lectin superfa...		Lus10037605 [exp]	3.5	0.9242
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10027716 [exp]	4.6	0.9237
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	9.2	0.9126
AT3G57810			Cysteine proteinases superfami...		Lus10037002 [exp]	9.4	0.8718
AT5G46030			unknown protein		Lus10015293 [exp]	10.0	0.8936
AT1G55840			Sec14p-like phosphatidylinosit...		Lus10022533 [exp]	10.2	0.9028
AT5G21910			unknown protein		Lus10038069 [exp]	11.2	0.9172
AT3G13550		EMB144, COP10, ...	FUSCA 9, EMBRYO DEFECTIVE 144,...		Lus10034996 [exp]	12.5	0.8086

Compare expression of checked genes

Lus10022604 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.