Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09890 181 / 1e-58 Ankyrin repeat family protein (.1.2) AT2G28840 66 / 4e-13 XBAT31 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) AT5G40160 64 / 8e-13 EMB139, EMB506 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) AT2G03430 62 / 5e-12 Ankyrin repeat family protein (.1) AT2G25600 62 / 9e-12 AKT6, SPIK Shaker pollen inward K+ channel, Shaker pollen inward K+ channel (.1) AT4G19150 60 / 2e-11 Ankyrin repeat family protein (.1.2) AT4G32500 56 / 1e-09 AKT5 K+ transporter 5, K+ transporter 5, K+ transporter 5 (.1) AT2G26650 56 / 1e-09 AKT1, ATAKT1 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) AT5G12320 54 / 1e-09 ankyrin repeat family protein (.1) AT5G57740 54 / 8e-09 XBAT32 XB3 ortholog 2 in Arabidopsis thaliana (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021508 [exp] 254 / 9e-88 AT3G09890 209 / 5e-69 Ankyrin repeat family protein (.1.2) Lus10023911 [exp] 226 / 2e-76 AT3G09890 219 / 6e-73 Ankyrin repeat family protein (.1.2) Lus10014410 [exp] 221 / 3e-74 AT3G09890 217 / 5e-72 Ankyrin repeat family protein (.1.2) Lus10014522 [exp] 69 / 3e-14 AT5G40160 322 / 3e-109 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Lus10032165 [exp] 65 / 9e-13 AT5G40160 293 / 3e-98 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Lus10033052 [exp] 61 / 2e-11 AT2G26650 1211 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10017765 [exp] 61 / 3e-11 AT2G26650 395 / 1e-130 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10040829 [exp] 57 / 3e-10 AT2G28840 546 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Lus10016561 [exp] 56 / 9e-10 AT2G28840 640 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G097900 [exp] 207 / 5e-69 AT3G09890 214 / 5e-71 Ankyrin repeat family protein (.1.2) Potri.006G121500 [exp] 206 / 8e-69 AT3G09890 196 / 1e-63 Ankyrin repeat family protein (.1.2) Potri.001G295200 [exp] 66 / 2e-13 AT5G40160 317 / 4e-108 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Potri.001G238800 [exp] 58 / 2e-10 AT2G28840 657 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Potri.010G161300 [exp] 57 / 3e-10 AT2G03430 356 / 1e-125 Ankyrin repeat family protein (.1) Potri.009G030000 [exp] 57 / 4e-10 AT2G28840 619 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Potri.012G139100 [exp] 56 / 9e-10 AT5G07270 782 / 0.0 XB3 ortholog 3 in Arabidopsis thaliana (.1) Potri.002G213200 [exp] 54 / 4e-09 AT2G03430 96 / 2e-22 Ankyrin repeat family protein (.1) Potri.001G187600 [exp] 54 / 5e-09 AT5G50140 280 / 3e-86 Ankyrin repeat family protein (.1) Potri.001G130500 [exp] 53 / 6e-09 AT4G19150 222 / 1e-72 Ankyrin repeat family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [flax] [poplar] Ank PF00023 [flax] [poplar] Ank Ankyrin repeat
Representative CDS sequence Show only first row Show all	>Lus10022609 pacid=23178669 polypeptide=Lus10022609 locus=Lus10022609.g ID=Lus10022609.BGIv1.0 annot-version=v1.0 ATGATTTCTAATGGAGACATCAAAATAACAAACAACATTGACGAGCCATTGGAAGATGGCGACACGGCTCTCCATCCGGCTTGTCTGTATGGATACTCGA GCTGTGTTAGGGTCCTGTTGGAACTGGGAGCAAACATAGAGGATAAGGATGAAGATGGGGCAATCCCTCTACATGATGCTTCTGCTGGTGCTATGGCAGG ATATACTGAGATAGTGCAGCTTCTGCTAAACCATGCTAATGATGCTGAGGCTGTGAAGAGGATGCTAGAGACAATGGATGACGAGGGTGATACTCCACTC CACCACGCTGCGAGAGGGGAGCACGCGGAGGTCGTGAACCTGTTGCTGGCTTCTGGCGCTTCAGTAACTCGAACAAACTCGTACGGAAAGACTCCAAGTG AGCTGGCTGATCCAGAAACAGAAGCTAGGAGAATCCTGGAAGGCAGTGCCTCATCTCAATGA
AA sequence Show only first row Show all	>Lus10022609 pacid=23178669 polypeptide=Lus10022609 locus=Lus10022609.g ID=Lus10022609.BGIv1.0 annot-version=v1.0 MISNGDIKITNNIDEPLEDGDTALHPACLYGYSSCVRVLLELGANIEDKDEDGAIPLHDASAGAMAGYTEIVQLLLNHANDAEAVKRMLETMDDEGDTPL HHAARGEHAEVVNLLLASGASVTRTNSYGKTPSELADPETEARRILEGSASSQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09890			Ankyrin repeat family protein ...		Lus10022609 [exp]	0	1
AT1G71250			GDSL-like Lipase/Acylhydrolase...		Lus10039152 [exp]	1.0	0.7971
AT3G50830		ATCOR413-PM2, C...	cold-regulated 413-plasma memb...		Lus10016782 [exp]	1.4	0.7192
AT2G18180			Sec14p-like phosphatidylinosit...		Lus10041779 [exp]	9.2	0.6618
AT1G13710		CYP78A5, KLUH	KLUH, "cytochrome P450, family...		Lus10015788 [exp]	10.4	0.6632
AT3G59800			unknown protein		Lus10027089 [exp]	15.9	0.6265
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10009928 [exp]	19.1	0.6338
					Lus10027457 [exp]	20.7	0.6276
AT4G24580		REN1	ROP1 ENHANCER 1, Rho GTPase ac...		Lus10005733 [exp]	22.2	0.6238
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10003345 [exp]	23.3	0.6174
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10003585 [exp]	24.0	0.6174

Compare expression of checked genes

Lus10022609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.