Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36830 403 / 4e-144 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT4G01470 387 / 8e-138 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT3G26520 383 / 4e-136 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT3G16240 290 / 2e-99 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT5G47450 285 / 2e-97 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT1G73190 285 / 3e-97 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT1G17810 274 / 6e-93 BETA-TIP beta-tonoplast intrinsic protein (.1) AT4G17340 265 / 1e-89 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT2G25810 239 / 1e-79 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT3G47440 176 / 3e-54 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021510 [exp] 487 / 4e-177 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10023913 [exp] 438 / 7e-158 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10014411 [exp] 431 / 8e-155 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 382 / 1e-135 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10040863 [exp] 378 / 4e-134 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1) Lus10003288 [exp] 364 / 1e-128 AT4G01470 388 / 6e-138 tonoplast intrinsic protein 1;3 (.1) Lus10038293 [exp] 288 / 2e-98 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10025808 [exp] 280 / 4e-95 AT3G16240 389 / 2e-138 delta tonoplast integral protein (.1) Lus10038324 [exp] 268 / 2e-90 AT1G73190 380 / 1e-134 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G098200 [exp] 416 / 6e-149 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.006G121700 [exp] 412 / 2e-147 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.008G050700 [exp] 384 / 1e-136 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.010G209900 [exp] 382 / 1e-135 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.001G235300 [exp] 376 / 3e-133 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1) Potri.009G027200 [exp] 369 / 2e-130 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1) Potri.004G216500 [exp] 358 / 3e-126 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1) Potri.009G005400 [exp] 354 / 1e-124 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.017G154800 [exp] 295 / 2e-101 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1) Potri.018G152100 [exp] 295 / 2e-101 AT1G17810 350 / 8e-123 beta-tonoplast intrinsic protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10022611 pacid=23178529 polypeptide=Lus10022611 locus=Lus10022611.g ID=Lus10022611.BGIv1.0 annot-version=v1.0 ATGCCGATCAGAAACATTGCTGTAGGCCACGTCGGTGAGGCCACTCACCCCGACGCGCTCAAGGCAGGGTTGGCCGAGTTCTTCTCCACCCTAATCTTCG TCTTCGCCGGAGAAGGTTCAGGCATGGCCTTCGCCAAGCTCACAGACGGCGCAGCCAACACCCCCTCCGGCCTTATTGCCGCCTCCATCGCCCACGCCTT CGCACTGTTTGTTGCTGTTTCAGTTGGCGCCAACATCTCCGGTGGCCACGTCAACCCCGCTGTCACCTTCGGCGCCTTCGTCGGAGGCAACATCACCCTC CTCCGCGGCATCGTGTACTGGATCGCCCAGCTCCTCGGTTCCACCGTCGCTTGCTTGCTCCTCAAGTTCGCCACCGGCGGCCTGGAAACGGCAGCGTTCA GCTTATCCGAGGGAGTCGGAGTGTGGAACGCCGTCGTTTTGGAGATTGTGATGACATTCGGTTTGGTCTACACCGTCTACGCTACTGCCGTGGACCCTAA GAAGGGAGACTTGGGGACCATCGCTCCGATCGCAATAGGTTTCATCGTCGGAGCCAACATTCTGGTCGGTGGAGCATTCTCCGGAGCTTCGATGAACCCG GCAGTGTCATTCGGGCCTGCTTTGGTCAGCTGGAGCTGGGTGAACCACTGGGTTTACTGGGTTGGACCCCTGATCGGAGCTGGAATTGCTGGGTTGGTCT ACGAGCTGATCTTTATCGGTCACGGGACCCACGAGCAGCTCCCAACCACTGACTACTGA
AA sequence Show only first row Show all	>Lus10022611 pacid=23178529 polypeptide=Lus10022611 locus=Lus10022611.g ID=Lus10022611.BGIv1.0 annot-version=v1.0 MPIRNIAVGHVGEATHPDALKAGLAEFFSTLIFVFAGEGSGMAFAKLTDGAANTPSGLIAASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITL LRGIVYWIAQLLGSTVACLLLKFATGGLETAAFSLSEGVGVWNAVVLEIVMTFGLVYTVYATAVDPKKGDLGTIAPIAIGFIVGANILVGGAFSGASMNP AVSFGPALVSWSWVNHWVYWVGPLIGAGIAGLVYELIFIGHGTHEQLPTTDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10022611 [exp]	0	1
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10021510 [exp]	1.0	0.9430
AT1G12310			Calcium-binding EF-hand family...		Lus10032205 [exp]	2.8	0.7648
AT3G16240		DELTA-TIP1, ATT...	delta tonoplast integral prote...		Lus10025808 [exp]	3.0	0.8448
AT1G78300		14-3-3OMEGA, GF...	14-3-3 PROTEIN G-BOX FACTOR14 ...		Lus10008715 [exp]	15.0	0.7180
AT3G59920		ATGDI2	RAB GDP dissociation inhibitor...		Lus10008341 [exp]	18.0	0.7349
AT1G78300		14-3-3OMEGA, GF...	14-3-3 PROTEIN G-BOX FACTOR14 ...		Lus10036481 [exp]	20.2	0.7318
AT1G08770		PRA1.E	prenylated RAB acceptor 1.E (....		Lus10042535 [exp]	20.3	0.8470
AT1G12240		ATBETAFRUCT4, V...	VACUOLAR INVERTASE, Glycosyl h...		Lus10028922 [exp]	30.0	0.7498
AT2G44050		COS1	coronatine insensitive1 suppre...		Lus10018133 [exp]	47.3	0.6604
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10030586 [exp]	54.5	0.7046

Compare expression of checked genes

Lus10022611 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.