Lus10022613 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G39210 164 / 5e-48 Major facilitator superfamily protein (.1)
AT2G28120 164 / 6e-48 Major facilitator superfamily protein (.1)
AT3G01930 97 / 1e-23 Major facilitator superfamily protein (.1.2)
AT5G14120 95 / 5e-23 Major facilitator superfamily protein (.1)
AT1G74780 92 / 9e-22 Nodulin-like / Major Facilitator Superfamily protein (.1)
AT5G50520 89 / 6e-21 Major facilitator superfamily protein (.1)
AT5G50630 89 / 6e-21 Major facilitator superfamily protein (.1)
AT2G34355 87 / 2e-20 Major facilitator superfamily protein (.1)
AT2G34350 86 / 8e-20 Nodulin-like / Major Facilitator Superfamily protein (.1)
AT1G18940 86 / 1e-19 Nodulin-like / Major Facilitator Superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014640 171 / 2e-50 AT2G39210 728 / 0.0 Major facilitator superfamily protein (.1)
Lus10033790 166 / 1e-48 AT2G39210 734 / 0.0 Major facilitator superfamily protein (.1)
Lus10037948 154 / 2e-44 AT2G39210 839 / 0.0 Major facilitator superfamily protein (.1)
Lus10038682 152 / 1e-43 AT2G39210 829 / 0.0 Major facilitator superfamily protein (.1)
Lus10037949 148 / 7e-42 AT2G39210 807 / 0.0 Major facilitator superfamily protein (.1)
Lus10021513 146 / 9e-42 AT2G39210 587 / 0.0 Major facilitator superfamily protein (.1)
Lus10022614 141 / 1e-39 AT2G39210 652 / 0.0 Major facilitator superfamily protein (.1)
Lus10021512 129 / 1e-38 AT2G39210 155 / 1e-45 Major facilitator superfamily protein (.1)
Lus10035203 102 / 2e-25 AT3G01930 876 / 0.0 Major facilitator superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G122400 172 / 7e-51 AT2G39210 767 / 0.0 Major facilitator superfamily protein (.1)
Potri.004G215600 164 / 2e-48 AT2G28120 810 / 0.0 Major facilitator superfamily protein (.1)
Potri.009G006400 162 / 2e-47 AT2G28120 845 / 0.0 Major facilitator superfamily protein (.1)
Potri.008G032901 156 / 4e-45 AT2G39210 830 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G194500 143 / 3e-43 AT2G28120 377 / 9e-130 Major facilitator superfamily protein (.1)
Potri.002G133900 145 / 5e-41 AT2G39210 666 / 0.0 Major facilitator superfamily protein (.1)
Potri.017G064201 100 / 6e-25 AT3G01930 805 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.001G329100 99 / 2e-24 AT3G01930 869 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.015G067000 96 / 3e-23 AT1G74780 562 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1)
Potri.012G098900 94 / 2e-22 AT5G14120 681 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF06813 Nodulin-like Nodulin-like
Representative CDS sequence
>Lus10022613 pacid=23178548 polypeptide=Lus10022613 locus=Lus10022613.g ID=Lus10022613.BGIv1.0 annot-version=v1.0
ATGCCTGTCGAAGCGTCCAATGTCAGATGTCTATCGGGGAAGAGCTTCCTCCGCCAGGTCATCATCGGGCGGTGGTTCATGTTCTTCGCAGCTTTACTAA
TCCAGGCCGGGTCAGGTGCCTCGTACATCTTCGGGATATATTCCCACGACATCAAATCCTCGCTAGGGTACGACCAATCCACGCTCAACCTCCTCGGGGT
TTTTGAAAGACCTCGGGGTCCTAGCCGGGTTAATCAACGAGGTGTTACCGGCGTGGGTTATACTATTGGTGGGTGCTATCATGAACTTCGATGCGTACTT
CATGATCGGCTCGCTGTCGTCGGGAAGATAGCCAAGCCTCCCGTGTGGCAGATGTGCATCTACATCTGCGTCGGAGCCAATTCTCAGGCGTTTGCCAACA
CGCGAGCACTGGTGACATGGGTGAAGAACTTCCCTGGAAGCAGAGGAGCAGTTTTAGGGCTATTGAAAGGAATGGTGGGGCTAAGCGGAGCAATCCTCAC
TCTCTTCTATCGAGCATTACCAAGTCGTTGA
AA sequence
>Lus10022613 pacid=23178548 polypeptide=Lus10022613 locus=Lus10022613.g ID=Lus10022613.BGIv1.0 annot-version=v1.0
MPVEASNVRCLSGKSFLRQVIIGRWFMFFAALLIQAGSGASYIFGIYSHDIKSSLGYDQSTLNLLGVFERPRGPSRVNQRGVTGVGYTIGGCYHELRCVL
HDRLAVVGKIAKPPVWQMCIYICVGANSQAFANTRALVTWVKNFPGSRGAVLGLLKGMVGLSGAILTLFYRALPSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G39210 Major facilitator superfamily ... Lus10022613 0 1

Lus10022613 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.