Lus10022616 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03455 220 / 3e-75 ACR2, ARATH;CDC25, CDC25 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021515 264 / 6e-93 AT5G03455 222 / 3e-76 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10014420 198 / 9e-64 AT5G03455 199 / 2e-63 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10023923 192 / 2e-61 AT5G03455 195 / 4e-62 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G122700 217 / 2e-74 AT5G03455 218 / 2e-74 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10022616 pacid=23178573 polypeptide=Lus10022616 locus=Lus10022616.g ID=Lus10022616.BGIv1.0 annot-version=v1.0
ATGGCTCGAAGCATATCGTACATAACAGGAACTCAGCTTCTCTCTCTCAAGCGCCGCCCAAATATCGCCATAATCGATGTCAGGGATGACGAGAGGAGCT
ACGACGGACATATCGCCGGATCTCTCCACTACGCCAGCGGCGGATTCGGCGATAAGATGTCTAGTCTGATTCAGGAGGTCAAAGGGAAGAAGGACACTCT
GGTCTTCCATTGCGCTCTTAGCCAGGTTCGTGGTCCAACCTGCGCAAGAAGGCTGGCTGATTACCTAACCGCGTCAAAAGACGATGCAGGAATCAAGAAT
GTGATGGTACTAGAGCATGGGTTCAACGGCTGGGAGGCTGCTGGCAAACCCGTTTGTCGCTGCATTGATGTTCCTTGCAAAGGTAAATGTCTGTAA
AA sequence
>Lus10022616 pacid=23178573 polypeptide=Lus10022616 locus=Lus10022616.g ID=Lus10022616.BGIv1.0 annot-version=v1.0
MARSISYITGTQLLSLKRRPNIAIIDVRDDERSYDGHIAGSLHYASGGFGDKMSSLIQEVKGKKDTLVFHCALSQVRGPTCARRLADYLTASKDDAGIKN
VMVLEHGFNGWEAAGKPVCRCIDVPCKGKCL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10022616 0 1
AT5G49710 unknown protein Lus10000765 3.2 0.9619
AT4G32180 ATPANK2 pantothenate kinase 2 (.1.2.3) Lus10013019 4.7 0.9584
AT4G17960 unknown protein Lus10000314 5.9 0.9544
AT4G33690 unknown protein Lus10040497 6.6 0.9387
AT4G28240 Wound-responsive family protei... Lus10039758 6.7 0.9555
AT4G27130 Translation initiation factor ... Lus10027181 7.2 0.9519
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10022727 7.5 0.9584
AT1G11530 ATCXXS1 C-terminal cysteine residue is... Lus10018383 7.5 0.9562
AT5G53160 RCAR3, PYL8 PYR1-like 8, regulatory compon... Lus10039335 11.5 0.9550
AT2G46680 HD ATHB7, ATHB-7 ARABIDOPSIS THALIANA HOMEOBOX ... Lus10005997 12.0 0.9536

Lus10022616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.