Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17030 40 / 6e-05 F-box family protein with a domain of unknown function (DUF295) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021517 [exp] 106 / 1e-28 AT2G17030 166 / 2e-47 F-box family protein with a domain of unknown function (DUF295) (.1) Lus10022650 [exp] 44 / 4e-06 AT2G17030 96 / 4e-22 F-box family protein with a domain of unknown function (DUF295) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022619 pacid=23178589 polypeptide=Lus10022619 locus=Lus10022619.g ID=Lus10022619.BGIv1.0 annot-version=v1.0 ATGGCTGCACTGCGAGGAACTGCGTATTCTTGGCCGACACTCGCGAAGAAAGGCAGCCAGTGTAGAGATGGATTCTCTAATACGCTGGTGTTCGGATTGG AACATCGCGAAGTGATGCTATTGACAAAACGTTCAGAGTACTCCAAGCTGTTCTGGCCACCTCCAGAGTGGCTATCAAACCACGTCACTGCTATAACAGG ACCCGAGGAGCAAGGATTGAAGGGATGTCCCTCCAAAACAATCCCCAGTGAACTGGTTCCCCCATTTCAATACCAGAAAGCTTGA
AA sequence Show only first row Show all	>Lus10022619 pacid=23178589 polypeptide=Lus10022619 locus=Lus10022619.g ID=Lus10022619.BGIv1.0 annot-version=v1.0 MAALRGTAYSWPTLAKKGSQCRDGFSNTLVFGLEHREVMLLTKRSEYSKLFWPPPEWLSNHVTAITGPEEQGLKGCPSKTIPSELVPPFQYQKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17030			F-box family protein with a do...		Lus10022619 [exp]	0	1
AT2G39730		RCA	rubisco activase (.1.2.3)		Lus10035616 [exp]	1.0	0.9998
					Lus10011218 [exp]	2.0	0.9961
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006693 [exp]	3.0	0.9918
AT5G18460			Protein of Unknown Function (D...		Lus10006861 [exp]	3.5	0.9918
AT5G12060			Plant self-incompatibility pro...		Lus10023085 [exp]	3.9	0.9918
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	4.9	0.9365
AT5G03620			Subtilisin-like serine endopep...		Lus10003254 [exp]	5.3	0.9286
AT5G59550			zinc finger (C3HC4-type RING f...		Lus10028009 [exp]	5.8	0.8062
					Lus10028652 [exp]	6.0	0.8602
AT1G62310			transcription factor jumonji (...		Lus10004603 [exp]	6.3	0.9018

Compare expression of checked genes

Lus10022619 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.