Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003319 [exp] 149 / 7e-47 AT2G45250 85 / 1e-20 Integral membrane protein hemolysin-III homolog (.1.2) Lus10023933 [exp] 64 / 5e-13 AT2G45250 106 / 4e-28 Integral membrane protein hemolysin-III homolog (.1.2) Lus10014432 [exp] 63 / 1e-12 AT2G45250 103 / 3e-27 Integral membrane protein hemolysin-III homolog (.1.2) Lus10022622 [exp] 45 / 2e-06 AT4G38280 110 / 2e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G166100 [exp] 49 / 5e-08 AT4G38280 106 / 4e-28 unknown protein Potri.004G205200 [exp] 39 / 0.0002 AT4G38280 100 / 6e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022623 pacid=23178637 polypeptide=Lus10022623 locus=Lus10022623.g ID=Lus10022623.BGIv1.0 annot-version=v1.0 ATGAGCTCAATGTGTCTTCAGATGGTTCAGCAAATGATGGACAAAACAGAACCAGACTCTTCTACTGATCATAAAGAGTTTTCTGTAAAGAAAGCAGCTT TGAGAGATGTTCAGAACCAAACTAGTTCTCACAGCTTCATTACTAGGTCTCCAGTAAGTAATAAGAAGAGTACTGGGAAAACCATGGATGCTCATACCTT CAAGGTCTCCGGCACCAAGAGACCCTCCCCCGAGCAGTCTCCGAATAGCAATGCAGCTGCAAATGCTCAACAACTCGTCTATGTTCGTAGGAAATCCGAA CAAAACCCTAATTATTCTATATATTCACTAACAAAATCCTAA
AA sequence Show only first row Show all	>Lus10022623 pacid=23178637 polypeptide=Lus10022623 locus=Lus10022623.g ID=Lus10022623.BGIv1.0 annot-version=v1.0 MSSMCLQMVQQMMDKTEPDSSTDHKEFSVKKAALRDVQNQTSSHSFITRSPVSNKKSTGKTMDAHTFKVSGTKRPSPEQSPNSNAAANAQQLVYVRRKSE QNPNYSIYSLTKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022623 [exp]	0	1
AT4G38280			unknown protein		Lus10022622 [exp]	1.0	0.8180
AT5G02440			unknown protein		Lus10000246 [exp]	16.3	0.7059
AT1G33330			Class I peptide chain release ...		Lus10032675 [exp]	20.3	0.7302
AT1G19670		CORI1, ATHCOR1,...	CORONATINE-INDUCED PROTEIN 1, ...		Lus10014702 [exp]	23.6	0.7636
					Lus10010602 [exp]	24.5	0.6528
AT4G30580		LPAT1, ATS2, EM...	lysophosphatidic acid acyltran...		Lus10022158 [exp]	25.6	0.7417
AT1G03910			unknown protein		Lus10030000 [exp]	26.5	0.7374
AT4G34180			Cyclase family protein (.1)		Lus10031454 [exp]	28.3	0.7147
					Lus10030126 [exp]	29.4	0.7066
AT2G38570			unknown protein		Lus10022733 [exp]	31.2	0.7461

Compare expression of checked genes

Lus10022623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.