Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36760 92 / 1e-22 UGT73C2 UDP-glucosyl transferase 73C2 (.1) AT2G36800 91 / 2e-22 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1) AT2G36790 89 / 1e-21 UGT73C6 UDP-glucosyl transferase 73C6 (.1) AT2G36780 85 / 2e-20 UDP-Glycosyltransferase superfamily protein (.1) AT2G36750 84 / 4e-20 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1) AT3G53150 81 / 5e-19 UGT73D1 UDP-glucosyl transferase 73D1 (.1) AT2G36770 80 / 2e-18 UDP-Glycosyltransferase superfamily protein (.1) AT3G53160 77 / 1e-17 UGT73C7 UDP-glucosyl transferase 73C7 (.1) AT4G34138 71 / 3e-15 UGT73B1 UDP-glucosyl transferase 73B1 (.1) AT2G15490 69 / 6e-15 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003322 [exp] 198 / 2e-62 AT2G36780 468 / 9e-162 UDP-Glycosyltransferase superfamily protein (.1) Lus10016268 [exp] 139 / 4e-40 AT2G36780 498 / 1e-173 UDP-Glycosyltransferase superfamily protein (.1) Lus10003323 [exp] 122 / 8e-34 AT2G36800 493 / 2e-171 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1) Lus10014437 [exp] 107 / 4e-28 AT2G36780 545 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Lus10022628 [exp] 106 / 4e-28 AT2G36780 310 / 1e-101 UDP-Glycosyltransferase superfamily protein (.1) Lus10012011 [exp] 104 / 2e-27 AT2G36780 488 / 8e-170 UDP-Glycosyltransferase superfamily protein (.1) Lus10023939 [exp] 101 / 4e-26 AT2G36780 485 / 7e-169 UDP-Glycosyltransferase superfamily protein (.1) Lus10023893 [exp] 84 / 6e-20 AT2G36780 495 / 1e-172 UDP-Glycosyltransferase superfamily protein (.1) Lus10014401 [exp] 77 / 2e-17 AT3G53150 537 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G048700 [exp] 88 / 3e-21 AT2G36800 550 / 0.0 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1) Potri.016G097400 [exp] 82 / 3e-19 AT3G53150 626 / 0.0 UDP-glucosyl transferase 73D1 (.1) Potri.009G098400 [exp] 79 / 4e-18 AT2G15490 505 / 8e-177 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.006G120600 [exp] 79 / 4e-18 AT3G53150 617 / 0.0 UDP-glucosyl transferase 73D1 (.1) Potri.018G008900 [exp] 75 / 7e-17 AT2G15490 312 / 1e-101 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.001G302300 [exp] 75 / 8e-17 AT4G34131 488 / 4e-170 UDP-glucosyl transferase 73B3 (.1) Potri.005G036100 [exp] 75 / 1e-16 AT2G15490 309 / 3e-100 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.006G272600 [exp] 74 / 2e-16 AT2G15490 300 / 1e-96 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.002G123700 [exp] 73 / 4e-16 AT4G34131 446 / 3e-153 UDP-glucosyl transferase 73B3 (.1) Potri.006G272500 [exp] 73 / 4e-16 AT2G15490 318 / 1e-103 UDP-glycosyltransferase 73B4 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022627 pacid=23178528 polypeptide=Lus10022627 locus=Lus10022627.g ID=Lus10022627.BGIv1.0 annot-version=v1.0 ATGGATTCAGATCCAACAACCACCATCAAAACCCAGCAACCTCATTTCCTTCTCTTCCCATTCATGGCGCAAGGCCACATGATTCCCATGGACATCACCA AGCTCCTAGCTAGCCATGGTGGAGGAGAACTAATCATGATCACAATCATCACCATCCCGGTCAACGCAGCTCGATCTAGACACTCTCTCTCAGGCCACCA CAGAATCAAGCTGGTTGAGTTACGGTTCCCCTGCATTGAAGCAGGGCTACCGGAGGGTTGCGAGAACATCGGCATGCTCCCTTCGTTCGACTATCTCCCT CACCTGTACAAGGCCGTGGGCATGATGGAATCTCAGATGGGGTGGACATTCGGTTACAGTTAG
AA sequence Show only first row Show all	>Lus10022627 pacid=23178528 polypeptide=Lus10022627 locus=Lus10022627.g ID=Lus10022627.BGIv1.0 annot-version=v1.0 MDSDPTTTIKTQQPHFLLFPFMAQGHMIPMDITKLLASHGGGELIMITIITIPVNAARSRHSLSGHHRIKLVELRFPCIEAGLPEGCENIGMLPSFDYLP HLYKAVGMMESQMGWTFGYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36800		UGT73C5, DOGT1	UDP-GLUCOSYL TRANSFERASE 73C5,...		Lus10022627 [exp]	0	1
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10013802 [exp]	2.0	0.8694
AT4G09960	MADS	AGL11, STK	SEEDSTICK, AGAMOUS-like 11, K-...		Lus10008264 [exp]	2.4	0.8925
AT3G29635			HXXXD-type acyl-transferase fa...		Lus10021388 [exp]	10.2	0.8521
AT5G25900		ATKO1, CYP701A3...	CYTOCHROME P450 701 A3, ARABID...		Lus10042641 [exp]	11.5	0.8179
AT1G15780			unknown protein		Lus10015321 [exp]	18.7	0.8510
AT3G47570			Leucine-rich repeat protein ki...		Lus10031043 [exp]	23.3	0.8010
AT1G64060		RBOHAP108, ATRB...	ARABIDOPSIS THALIANA RESPIRATO...		Lus10017850 [exp]	24.2	0.8424
AT4G27870			Vacuolar iron transporter (VIT...		Lus10037315 [exp]	25.3	0.8653
AT1G19630		CYP722A1	"cytochrome P450, family 722, ...		Lus10014285 [exp]	33.3	0.8385
AT1G65610		ATGH9A2 ,KOR2	KORRIGAN 2, ARABIDOPSIS THALIA...		Lus10026863 [exp]	39.4	0.8493

Compare expression of checked genes

Lus10022627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.