Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26880 64 / 6e-14 Plant self-incompatibility protein S1 family (.1) AT4G16295 60 / 3e-12 SPH1 S-protein homologue 1 (.1) AT1G11765 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) AT5G04350 57 / 5e-11 Plant self-incompatibility protein S1 family (.1) AT4G29035 56 / 8e-11 Plant self-incompatibility protein S1 family (.1) AT1G04645 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) AT1G28305 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) AT3G27680 51 / 7e-09 Plant self-incompatibility protein S1 family (.1) AT2G06090 49 / 4e-08 Plant self-incompatibility protein S1 family (.1) AT5G04347 47 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003327 [exp] 255 / 2e-89 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1) Lus10022830 [exp] 79 / 2e-19 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1) Lus10011892 [exp] 79 / 2e-19 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1) Lus10022824 [exp] 72 / 9e-17 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1) Lus10022826 [exp] 70 / 4e-16 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1) Lus10029390 [exp] 69 / 2e-15 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1) Lus10011897 [exp] 66 / 1e-14 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10014630 [exp] 65 / 2e-14 AT5G38435 57 / 1e-11 S-protein homologue 8 (.1) Lus10011895 [exp] 66 / 3e-14 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 77 / 8e-19 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 70 / 7e-16 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.002G252500 [exp] 66 / 1e-14 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.004G199801 [exp] 52 / 4e-09 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1) Potri.010G008300 [exp] 49 / 3e-08 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 49 / 5e-08 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 47 / 3e-07 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 44 / 4e-06 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.001G053100 [exp] 43 / 8e-06 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 42 / 9e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10022631 pacid=23178570 polypeptide=Lus10022631 locus=Lus10022631.g ID=Lus10022631.BGIv1.0 annot-version=v1.0 ATGATCAGCTCAGTTCCGGCGGCAGAGGCGGTGACGGTGCGGGTAATACACGGTCTGAGCGACCACCGGAAGAGAATGCTGGTACACTGCAAGTCCGGCG ACGACGACATCGGGAACCAGTACATAGTCGCAGGTGGCGACGACTACCATTTCGAGTTCTCCCCGAACATATGGGGGAACACTCTGTTCTGGTGCTACGT GGCGCCTGACGCCAACACCCACACGTCCTTCACGGCGTGGGCCGACGACGACCCGTTGATTCCGGCGGGGAACCTCGACGACGTGACGTGGCTGGCTAAA GACGACGGCATGTACGTCAAGCGTAGGATTAGGAACGAGAAGAACTTCAGTTTCTATAGGAAGTGGAGTTACGGGAAGTAG
AA sequence Show only first row Show all	>Lus10022631 pacid=23178570 polypeptide=Lus10022631 locus=Lus10022631.g ID=Lus10022631.BGIv1.0 annot-version=v1.0 MISSVPAAEAVTVRVIHGLSDHRKRMLVHCKSGDDDIGNQYIVAGGDDYHFEFSPNIWGNTLFWCYVAPDANTHTSFTAWADDDPLIPAGNLDDVTWLAK DDGMYVKRRIRNEKNFSFYRKWSYGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	0	1
					Lus10000351 [exp]	2.0	1.0000
					Lus10002886 [exp]	2.8	1.0000
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	3.5	1.0000
					Lus10014748 [exp]	4.0	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	5.0	1.0000
					Lus10022162 [exp]	5.5	0.7497
					Lus10023108 [exp]	5.5	1.0000
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10023249 [exp]	5.9	1.0000
					Lus10024321 [exp]	6.3	1.0000
					Lus10036778 [exp]	6.5	0.8695

Compare expression of checked genes

Lus10022631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.