Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01435 174 / 9e-58 Expressed protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003331 [exp] 241 / 8e-84 AT3G01435 175 / 6e-58 Expressed protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G001600 [exp] 181 / 5e-60 AT3G01435 169 / 1e-55 Expressed protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10280 [flax] [poplar] Med11 Mediator complex protein
Representative CDS sequence Show only first row Show all	>Lus10022634 pacid=23178622 polypeptide=Lus10022634 locus=Lus10022634.g ID=Lus10022634.BGIv1.0 annot-version=v1.0 ATGGAGTCGCCGTCGCAGAACACCTCACTGCACCGCCTTCAGAACGTGGAGAAGACGATTGTCAAGGTTTTGGAGCTAGCTGGAGGAGTGATGGATGAAC TGGCGAATCCTATGGGTCCTAGGAAGGAATTCATCAACAGCCATTGTCGCGAGTTCATGCAAATGATCAAGGATATCCAATTTACTCTGCGGAACGAGAT CAAGAGCACCTGTGAGTACCGTCCTTTCGAGAAGTGTGATTACAGCTCAAGAATATCAAACGAAATCTGCTTCGACAAAATAGAGTATCTGCTTTCCCAT CTGGATGGTATGACCAAAGCTGTCGAACGATACCATGCTGATGCTGCTACTGCTACTGCTGCCGATGTCCCATCCCCAATCAGTGAATGA
AA sequence Show only first row Show all	>Lus10022634 pacid=23178622 polypeptide=Lus10022634 locus=Lus10022634.g ID=Lus10022634.BGIv1.0 annot-version=v1.0 MESPSQNTSLHRLQNVEKTIVKVLELAGGVMDELANPMGPRKEFINSHCREFMQMIKDIQFTLRNEIKSTCEYRPFEKCDYSSRISNEICFDKIEYLLSH LDGMTKAVERYHADAATATAADVPSPISE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01435			Expressed protein (.1)		Lus10022634 [exp]	0	1
AT5G40080			Mitochondrial ribosomal protei...		Lus10003002 [exp]	8.3	0.8520
AT3G55000		TON1A	TONNEAU 1A, TONNEAU 1, tonneau...		Lus10001983 [exp]	8.5	0.8257
AT2G18290		EMB2783, APC10	EMBRYO DEFECTIVE 2783, anaphas...		Lus10041756 [exp]	11.5	0.8207
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	14.9	0.8388
AT2G30620			winged-helix DNA-binding trans...		Lus10022001 [exp]	15.5	0.8210
AT3G51150			ATP binding microtubule motor ...		Lus10033920 [exp]	15.6	0.7559
AT3G09500			Ribosomal L29 family protein ...		Lus10003306 [exp]	16.1	0.8335
AT4G13720			Inosine triphosphate pyrophosp...		Lus10011757 [exp]	20.5	0.8287
AT1G19690			NAD(P)-binding Rossmann-fold s...		Lus10024280 [exp]	20.8	0.7863
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Lus10031896 [exp]	20.9	0.8043

Compare expression of checked genes

Lus10022634 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.