Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35190 355 / 1e-125 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT2G37210 324 / 2e-113 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT2G28305 322 / 1e-112 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT3G53450 320 / 8e-112 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT5G06300 317 / 1e-110 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT2G35990 295 / 3e-102 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT5G11950 285 / 4e-98 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 261 / 2e-88 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 161 / 2e-50 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 45 / 1e-05 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003335 [exp] 444 / 1e-160 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 372 / 7e-132 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10023967 [exp] 354 / 9e-125 AT4G35190 358 / 1e-126 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10026513 [exp] 328 / 8e-115 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10016096 [exp] 326 / 4e-114 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10021462 [exp] 325 / 5e-114 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10002226 [exp] 319 / 1e-111 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10012436 [exp] 309 / 1e-107 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10023190 [exp] 307 / 1e-106 AT2G37210 364 / 6e-130 LONELY GUY 3, lysine decarboxylase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G181800 [exp] 378 / 9e-135 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.009G141500 [exp] 372 / 3e-132 AT4G35190 357 / 2e-126 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.002G012500 [exp] 371 / 4e-132 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.005G248900 [exp] 364 / 3e-129 AT4G35190 297 / 7e-103 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.016G090500 [exp] 325 / 1e-113 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.006G127400 [exp] 323 / 4e-113 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 322 / 1e-112 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 318 / 4e-111 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.006G204800 [exp] 311 / 3e-108 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.002G024000 [exp] 307 / 8e-107 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [flax] [poplar] SLOG PF03641 [flax] [poplar] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Lus10022638 pacid=23178678 polypeptide=Lus10022638 locus=Lus10022638.g ID=Lus10022638.BGIv1.0 annot-version=v1.0 ATGAACACGGAAAAAGAATCACCATCGGAAGAGAAACAACAACCCACTGGAGCTGCCAAGTCCAGATTCAAGAAAGTTTGCGTCTTTTGCGGAAGCAGTA CTGGGAAAAGAATCTGTTACAGAGACGCCGCCGTTGAGCTTGCTCAGGAGCTGGTGGCGAGGAGGTTGGATCTCGTCTATGGCGGTGGGAGCATTGGGCT AATGGGTTTAGTCTCGCAAACTGTTCATCTTGGCGGATGCAATGTTCTTGGGATCATACCGAGGACCTTGATGAGCAAGGAGATTACTGGTGAAACAGTT GGTGAGGTGAGACCAGTAGCCGACATGCACCAAAGGAAAGCTGAAATGGCCCGCCATTCCGATTGCTTCATTGCCCTACCAGGTGGGTATGGGACACTGG AGGAGTTGTTGGAAGTCATCACTTGGGCTCAGCTTGGAATCCATGACAAGCCTGTGGGTTTGCTGAATGTTGATGGATACTACAACAACCTGCTGACATT CATTGACAAAGCTGTGGATGATGGGTTCATCAAGCCTTCACAACGTAGTATCATTGTCTCAGCACCAAATGCCAAAGAACTGGTTCAGAAACTTGAGGAG TATGTGCCTGCACATGATGGGGTCATAGCCAAGGCAAGGTGGGAAGTTGAGAAGCAGCAGCCAGCATCTGCTACTCCGACTACTACCACTTTGCAGACTG AGATAGCTCTATGA
AA sequence Show only first row Show all	>Lus10022638 pacid=23178678 polypeptide=Lus10022638 locus=Lus10022638.g ID=Lus10022638.BGIv1.0 annot-version=v1.0 MNTEKESPSEEKQQPTGAAKSRFKKVCVFCGSSTGKRICYRDAAVELAQELVARRLDLVYGGGSIGLMGLVSQTVHLGGCNVLGIIPRTLMSKEITGETV GEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNNLLTFIDKAVDDGFIKPSQRSIIVSAPNAKELVQKLEE YVPAHDGVIAKARWEVEKQQPASATPTTTTLQTEIAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35190		LOG5	LONELY GUY 5, Putative lysine ...		Lus10022638 [exp]	0	1
AT5G41070		DRB5	dsRNA-binding protein 5 (.1)		Lus10035176 [exp]	1.4	0.9505
AT1G13230			Leucine-rich repeat (LRR) fami...		Lus10034261 [exp]	3.2	0.9407
AT3G02150	TCP	TFPD, PTF1, TCP...	TEOSINTE BRANCHED1, CYCLOIDEA ...		Lus10032984 [exp]	3.5	0.9350
					Lus10002011 [exp]	3.9	0.9333
AT1G73990		SPPA1, SPPA	signal peptide peptidase (.1)		Lus10013335 [exp]	4.5	0.9348
AT1G13230			Leucine-rich repeat (LRR) fami...		Lus10034384 [exp]	6.0	0.9094
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10014043 [exp]	6.7	0.8988
AT5G60970	TCP	TCP5	TEOSINTE BRANCHED 1, cycloidea...		Lus10034679 [exp]	7.9	0.9073
					Lus10035486 [exp]	8.4	0.8750
AT3G61250	MYB	LMI2, ATMYB17	LATE MERISTEM IDENTITY2, myb d...		Lus10027459 [exp]	9.8	0.9012

Compare expression of checked genes

Lus10022638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.