Lus10022651 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17020 61 / 1e-12 F-box/RNI-like superfamily protein (.1)
AT1G55590 36 / 0.0009 RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012518 143 / 1e-41 AT2G17020 548 / 0.0 F-box/RNI-like superfamily protein (.1)
Lus10023988 53 / 1e-09 AT2G17020 519 / 3e-178 F-box/RNI-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G139500 96 / 1e-24 AT2G17020 638 / 0.0 F-box/RNI-like superfamily protein (.1)
Potri.004G179571 86 / 3e-21 AT2G17020 665 / 0.0 F-box/RNI-like superfamily protein (.1)
Potri.011G169800 38 / 0.0002 AT1G55590 617 / 0.0 RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10022651 pacid=23178527 polypeptide=Lus10022651 locus=Lus10022651.g ID=Lus10022651.BGIv1.0 annot-version=v1.0
ATGGTAACCAAGCTGTTCAGTCCAAACGCGATACCTCGACCTCCAAATTCCGTCCAGCCAAGTAGTACTCTTCCCAACATCCGGAAGCTGTGCCTCTGTG
TGGACTGCATTACCGACACTATGGTCGCAACAATATCGAGCGGTTTGGTAACCTTGACACATCTAGATCTTCGAGATGCACCGTTCAGGGAACCAACTGT
TACGTCTGATCTCACCAACTCTGGCTCTTTTGCTGATTAA
AA sequence
>Lus10022651 pacid=23178527 polypeptide=Lus10022651 locus=Lus10022651.g ID=Lus10022651.BGIv1.0 annot-version=v1.0
MVTKLFSPNAIPRPPNSVQPSSTLPNIRKLCLCVDCITDTMVATISSGLVTLTHLDLRDAPFREPTVTSDLTNSGSFAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17020 F-box/RNI-like superfamily pro... Lus10022651 0 1
AT2G17020 F-box/RNI-like superfamily pro... Lus10022652 2.0 0.8785
AT5G53635 F-box/RNI-like/FBD-like domain... Lus10037604 3.7 0.7578
AT1G47570 RING/U-box superfamily protein... Lus10033472 8.0 0.8290
AT2G22300 CAMTA SR1, CAMTA3 CALMODULIN-BINDING TRANSCRIPTI... Lus10041704 8.1 0.8246
AT1G09730 Cysteine proteinases superfami... Lus10000917 11.2 0.7996
AT1G79750 ATNADP-ME4 Arabidopsis thaliana NADP-mali... Lus10034963 12.8 0.7537
AT3G11980 FAR2, MS2 MALE STERILITY 2, FATTY ACID R... Lus10029336 13.9 0.7666
AT5G55100 SWAP (Suppressor-of-White-APri... Lus10043105 14.6 0.8083
AT3G25840 Protein kinase superfamily pro... Lus10021688 15.7 0.7485
AT1G33400 TPR9 tetratricopeptide repeat 9, Te... Lus10026202 16.6 0.7933

Lus10022651 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.