Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35030 94 / 9e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62260 92 / 5e-23 MEF9 mitochondrial editing factor 9 (.1) AT1G32415 91 / 2e-22 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G09410 87 / 2e-21 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G29230 86 / 4e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02750 86 / 5e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G45350 85 / 1e-20 CRR4 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18840 84 / 3e-20 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G56690 81 / 6e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G13410 80 / 7e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012514 [exp] 97 / 5e-25 AT1G62260 689 / 0.0 mitochondrial editing factor 9 (.1) Lus10009290 [exp] 90 / 3e-22 AT2G45350 605 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030932 [exp] 89 / 5e-22 AT3G29230 318 / 3e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019797 [exp] 87 / 2e-21 AT3G29230 768 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10012897 [exp] 87 / 3e-21 AT4G02750 469 / 4e-156 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028907 [exp] 87 / 3e-21 AT4G22760 632 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014113 [exp] 86 / 5e-21 AT3G29230 767 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027455 [exp] 86 / 8e-21 AT3G29230 324 / 4e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013149 [exp] 85 / 1e-20 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G139200 [exp] 101 / 2e-26 AT1G62260 749 / 0.0 mitochondrial editing factor 9 (.1) Potri.016G038400 [exp] 93 / 2e-23 AT2G35030 701 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G125500 [exp] 90 / 2e-22 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G068800 [exp] 87 / 3e-21 AT2G45350 735 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G019900 [exp] 86 / 4e-21 AT4G02750 542 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G086100 [exp] 85 / 1e-20 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.008G106500 [exp] 84 / 2e-20 AT2G29760 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G005400 [exp] 84 / 2e-20 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G087300 [exp] 84 / 3e-20 AT1G32415 851 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.003G116100 [exp] 84 / 3e-20 AT4G22760 669 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10022655 pacid=23178670 polypeptide=Lus10022655 locus=Lus10022655.g ID=Lus10022655.BGIv1.0 annot-version=v1.0 ATGCGAAGGTTGGTACCTGGCCGTATTCTTCTATCATCAAAGGGAATAAATCCGTTCTCTTTGCGTTTCGCATCCACTAGCGTGTACGAATGGAACAAGA AGATCAGCGCACTGGAGAAAACCGGCCGGATTAACGAAGCACGCCAACTGTTCGACAGAATGCCTGATAGGAATGTGGTCTCATGGAACTCGATGGTGAG TGGGTACGCGAAGAGAGGGGAAATGACCAAAGCAGGCCAACTATTCGACTTAATGCCTCAGAGAGGTGTAGTACCGTGGAACACGATGATTTCCGGTTAC GTGTAG
AA sequence Show only first row Show all	>Lus10022655 pacid=23178670 polypeptide=Lus10022655 locus=Lus10022655.g ID=Lus10022655.BGIv1.0 annot-version=v1.0 MRRLVPGRILLSSKGINPFSLRFASTSVYEWNKKISALEKTGRINEARQLFDRMPDRNVVSWNSMVSGYAKRGEMTKAGQLFDLMPQRGVVPWNTMISGY V

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35030			Pentatricopeptide repeat (PPR)...		Lus10022655 [exp]	0	1
AT4G35130			Tetratricopeptide repeat (TPR)...		Lus10035619 [exp]	10.0	0.7708
AT1G48570			zinc finger (Ran-binding) fami...		Lus10009049 [exp]	19.8	0.7408
AT4G33680		AGD2	ABERRANT GROWTH AND DEATH 2, P...		Lus10010748 [exp]	29.8	0.7273
AT1G79120			Ubiquitin carboxyl-terminal hy...		Lus10014514 [exp]	31.0	0.7128
AT1G48570			zinc finger (Ran-binding) fami...		Lus10009681 [exp]	32.6	0.6120
AT3G06430		AtPPR2, EMB2750	pentatricopeptide repeat 2, em...		Lus10027552 [exp]	33.2	0.7224
AT3G49740			Tetratricopeptide repeat (TPR)...		Lus10011563 [exp]	44.9	0.7095
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Lus10029284 [exp]	58.0	0.6930
AT3G49170		EMB2261	embryo defective 2261, Tetratr...		Lus10042161 [exp]	63.7	0.6756
AT2G03880		REME1	required for efficiency of mit...		Lus10022974 [exp]	70.9	0.6530

Compare expression of checked genes

Lus10022655 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.