Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62260 100 / 2e-26 MEF9 mitochondrial editing factor 9 (.1) AT1G20230 91 / 1e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G02750 88 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G56310 86 / 4e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G13600 85 / 9e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G19191 85 / 1e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09190 84 / 1e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G18750 84 / 2e-20 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G49142 83 / 4e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G59600 83 / 6e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012514 [exp] 167 / 1e-50 AT1G62260 689 / 0.0 mitochondrial editing factor 9 (.1) Lus10000213 [exp] 88 / 9e-22 AT2G13600 435 / 8e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015225 [exp] 87 / 2e-21 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10034022 [exp] 86 / 4e-21 AT5G19020 353 / 7e-114 mitochondrial editing factor 18 (.1) Lus10018223 [exp] 86 / 6e-21 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030225 [exp] 85 / 8e-21 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005987 [exp] 85 / 1e-20 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013149 [exp] 84 / 2e-20 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026460 [exp] 84 / 2e-20 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G139200 [exp] 114 / 3e-31 AT1G62260 749 / 0.0 mitochondrial editing factor 9 (.1) Potri.012G140400 [exp] 92 / 3e-23 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G059400 [exp] 90 / 2e-22 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G175900 [exp] 88 / 6e-22 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G258500 [exp] 85 / 9e-21 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G258766 [exp] 84 / 3e-20 AT1G06150 705 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Potri.012G018800 [exp] 83 / 5e-20 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G090600 [exp] 83 / 5e-20 AT2G40720 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G243800 [exp] 82 / 8e-20 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G058900 [exp] 82 / 8e-20 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022656 pacid=23178565 polypeptide=Lus10022656 locus=Lus10022656.g ID=Lus10022656.BGIv1.0 annot-version=v1.0 ATGATTCCGAGAATTGAGCATTTCGCGTCGTTGGTTGACGTAATTTGCAGGGGTGGACAGCTTCAGGAAGCTTTGGTGTTGATCAGAGGCATGCCGTTCG AACCGGATAAGGCGATTTGGGGTGCATTGCTCGAGGGTTCAAGTGTGCATTACGACGTGAAGATGGCTCGAATTGCTGCTGATTCGTTGGCTAGGATCGA ACCGAGTGGATCTGCAGCGTATGTGTTGCTTCATAATATGTATGCTGAGTTGGGCTGTGGGATGAAGCTAGGCTGGTAA
AA sequence Show only first row Show all	>Lus10022656 pacid=23178565 polypeptide=Lus10022656 locus=Lus10022656.g ID=Lus10022656.BGIv1.0 annot-version=v1.0 MIPRIEHFASLVDVICRGGQLQEALVLIRGMPFEPDKAIWGALLEGSSVHYDVKMARIAADSLARIEPSGSAAYVLLHNMYAELGCGMKLGW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62260		MEF9	mitochondrial editing factor 9...		Lus10022656 [exp]	0	1
AT1G69210			Uncharacterised protein family...		Lus10026674 [exp]	3.3	0.8055
AT4G12040		AtSAP7	stress-associated protein 7, A...		Lus10030150 [exp]	4.5	0.7639
AT1G53330			Pentatricopeptide repeat (PPR)...		Lus10042452 [exp]	15.5	0.6850
AT3G53220			Thioredoxin superfamily protei...		Lus10026540 [exp]	21.4	0.7010
AT2G39170			unknown protein		Lus10018298 [exp]	32.6	0.6332
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015865 [exp]	38.3	0.5833
AT1G13410			Tetratricopeptide repeat (TPR)...		Lus10017243 [exp]	48.4	0.6806
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10021006 [exp]	58.5	0.6763
AT3G27050			unknown protein		Lus10010600 [exp]	66.9	0.5667
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10028837 [exp]	67.5	0.6247

Compare expression of checked genes

Lus10022656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.