Lus10022669 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 168 / 1e-51 Thioredoxin superfamily protein (.1)
AT4G12890 159 / 1e-48 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT5G01580 153 / 2e-46 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12870 149 / 1e-44 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 148 / 2e-44 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 135 / 3e-39 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012503 395 / 1e-141 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
Lus10042270 169 / 4e-52 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10026384 168 / 1e-51 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10002203 162 / 1e-49 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10022670 123 / 4e-32 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 105 / 1e-25 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G107600 202 / 7e-65 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 202 / 9e-65 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.016G122200 200 / 4e-64 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.016G121900 188 / 9e-60 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.006G103000 183 / 1e-57 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.009G076200 172 / 3e-53 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.001G281004 158 / 5e-48 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Potri.016G122000 154 / 8e-47 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Lus10022669 pacid=23178562 polypeptide=Lus10022669 locus=Lus10022669.g ID=Lus10022669.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCTCCATTTCTATCCTTTCTCCTCCTCTCTTCTTTGCTCTTCTCACCAATTCGATCTGACGATGGCTTTTTCGACGAGAAGGACGAGTCTG
ATCGAGTCAACTTGACTCTGTACTACGAAACTCGCTGCCCTTACTGCCGTGACTTCATCGTGAACCCTCTCGCCAAGGCTGTGGCTACCGATCTCATGAA
CATCGTCAATCTCAGACTCGTCCCTTGGGGCAATGCTTACGTTGAAGGCTCCCGAGTCATTTGTCAGCACGGCGTAGATGAATGCTACCTTAACACGATC
CACGCCTGCATTCTCACTATTGCGAAGCCACGGTTCCAGTTCGAATTCATCAAGTGCATCGAGGAGGAATGGTCGAGTAACCCGTCAATTGTATGGAGAA
CTTGTGCTAATGACTTGCGGTTCCCCCCAATTCCAATCGAGGGTTGCTATTATAACGGAATGGGAAAAAAGCTTCTGCTGAAGTATGGGGACGAGACTAT
GCACCTGCAGCCGCCTCTTCGAGGTGTACCGTGGGTCACTGTGAACGGTGTTCCACTGAATCAGGACTTCGAGAAGTTTGTATCGTATGTATGCAAAGCT
TATAGAGGCAAGTCGCTGCCTAATGCTTGCAGGACCCATAACCTCAACAACGAGAAGGAAAGTAGAGTGCAGCCAATCTGTTACAGAGCATAA
AA sequence
>Lus10022669 pacid=23178562 polypeptide=Lus10022669 locus=Lus10022669.g ID=Lus10022669.BGIv1.0 annot-version=v1.0
MASSPFLSFLLLSSLLFSPIRSDDGFFDEKDESDRVNLTLYYETRCPYCRDFIVNPLAKAVATDLMNIVNLRLVPWGNAYVEGSRVICQHGVDECYLNTI
HACILTIAKPRFQFEFIKCIEEEWSSNPSIVWRTCANDLRFPPIPIEGCYYNGMGKKLLLKYGDETMHLQPPLRGVPWVTVNGVPLNQDFEKFVSYVCKA
YRGKSLPNACRTHNLNNEKESRVQPICYRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07080 Thioredoxin superfamily protei... Lus10022669 0 1
Lus10011890 2.4 0.9148
AT5G23310 FSD3 Fe superoxide dismutase 3 (.1) Lus10010174 7.7 0.9192
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10019417 8.1 0.8808
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10015677 8.1 0.9243
AT2G24800 Peroxidase superfamily protein... Lus10026903 8.5 0.8976
AT5G13930 ATCHS, TT4, CHS TRANSPARENT TESTA 4, CHALCONE ... Lus10033717 10.5 0.8975
AT1G73530 RNA-binding (RRM/RBD/RNP motif... Lus10042293 13.4 0.8921
AT4G19420 Pectinacetylesterase family pr... Lus10034766 13.6 0.8779
AT3G12080 EMB2738 embryo defective 2738, GTP-bin... Lus10027371 14.3 0.9123
AT5G16030 unknown protein Lus10033537 14.4 0.8874

Lus10022669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.