Lus10022671 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20650 138 / 1e-42 COPT5 copper transporter 5 (.1)
AT5G59040 55 / 5e-10 COPT3 copper transporter 3 (.1)
AT2G26975 51 / 8e-09 Ctr copper transporter family (.1)
AT2G37925 44 / 4e-06 COPT4 copper transporter 4 (.1)
AT3G46900 42 / 3e-05 COPT2 copper transporter 2 (.1)
AT5G59030 41 / 7e-05 COPT1 copper transporter 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012501 224 / 1e-76 AT5G20650 177 / 5e-58 copper transporter 5 (.1)
Lus10007092 142 / 3e-44 AT5G20650 169 / 6e-55 copper transporter 5 (.1)
Lus10040925 111 / 5e-32 AT5G20650 142 / 2e-44 copper transporter 5 (.1)
Lus10009819 108 / 6e-31 AT5G20650 147 / 5e-46 copper transporter 5 (.1)
Lus10016464 56 / 3e-10 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10040726 50 / 4e-08 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10021108 49 / 2e-07 AT2G37925 120 / 2e-35 copper transporter 4 (.1)
Lus10021107 46 / 9e-07 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017204 44 / 2e-06 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G140700 164 / 8e-53 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
Potri.006G219200 134 / 4e-41 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
Potri.006G093300 51 / 2e-08 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.009G038700 50 / 4e-08 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093200 47 / 3e-07 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.009G038800 47 / 3e-07 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.001G246000 43 / 1e-05 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10022671 pacid=23178672 polypeptide=Lus10022671 locus=Lus10022671.g ID=Lus10022671.BGIv1.0 annot-version=v1.0
ATGCACATGACGTTCTACTGGGGAACCAAAGTAACCCTCCTAATCGATTCATGGAAGACGGATTCTTTACTCTCCTACCTCCTCACTCTGCTCGCCTGCT
TCCTCTTCTCCGCCTTCTACCAGTACCTCGAAGATCGCCGTATCCGATTCAAGTCCCTTTCTTCTTTTTCATCCGCAACCCAACCGCCGCCGTCAGTCGA
CGCTCCTCTCCTCCAGCTTCCCGAGCTCAATAGCAGCAGTCCGACCACCAAGTTTTTAGGAGCCCTACTGTTTGGAGTCAACTCCGCGATCGGCTACTTG
TTGATGCTCGCCGTCATGTCTTTCAACGGCGGCGTCTTCGTTGCTGTAGTCCTCGGCTTGACGATCGGGTACTTGTTGTTCCGATGCGGCGGAGACGAGG
AGGAGGTCGTCGTCGCTGTGGATAATACCTGCGCTTGTGCCTGA
AA sequence
>Lus10022671 pacid=23178672 polypeptide=Lus10022671 locus=Lus10022671.g ID=Lus10022671.BGIv1.0 annot-version=v1.0
MHMTFYWGTKVTLLIDSWKTDSLLSYLLTLLACFLFSAFYQYLEDRRIRFKSLSSFSSATQPPPSVDAPLLQLPELNSSSPTTKFLGALLFGVNSAIGYL
LMLAVMSFNGGVFVAVVLGLTIGYLLFRCGGDEEEVVVAVDNTCACA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20650 COPT5 copper transporter 5 (.1) Lus10022671 0 1
AT5G23230 NIC2 nicotinamidase 2 (.1) Lus10040988 1.4 0.8866
AT3G09770 LOG2 LOSS OF GDU 2, RING/U-box supe... Lus10023182 3.7 0.8845
AT5G20650 COPT5 copper transporter 5 (.1) Lus10012501 4.2 0.8501
AT1G08315 ARM repeat superfamily protein... Lus10039500 4.9 0.8663
AT5G08530 CI51 51 kDa subunit of complex I (.... Lus10015807 5.0 0.8633
AT4G10810 unknown protein Lus10023038 5.2 0.8672
AT1G12910 LWD1, ATAN11 LIGHT-REGULATED WD 1, ANTHOCYA... Lus10041500 5.7 0.8323
AT2G27180 unknown protein Lus10008446 6.0 0.8364
AT5G40650 SDH2-2 succinate dehydrogenase 2-2 (.... Lus10014879 6.9 0.8545
AT3G18215 Protein of unknown function, D... Lus10009010 7.2 0.8364

Lus10022671 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.