Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38310 245 / 7e-82 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 231 / 2e-76 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G05440 219 / 1e-71 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G26040 191 / 9e-61 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT1G01360 183 / 1e-57 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT5G53160 181 / 4e-57 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT4G17870 176 / 4e-55 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G27920 175 / 1e-54 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT4G01026 174 / 9e-54 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT1G73000 162 / 3e-49 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014239 [exp] 372 / 1e-131 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 265 / 2e-89 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 212 / 9e-70 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10002861 [exp] 205 / 4e-66 AT2G38310 176 / 7e-56 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 192 / 4e-61 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10029222 [exp] 189 / 5e-60 AT2G40330 182 / 2e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 185 / 2e-58 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10026430 [exp] 177 / 2e-55 AT2G26040 264 / 1e-90 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10014929 [exp] 176 / 1e-54 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G125400 [exp] 308 / 1e-106 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 306 / 2e-105 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 236 / 6e-78 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.008G073400 [exp] 228 / 6e-75 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.001G142500 [exp] 197 / 4e-63 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.018G054400 [exp] 191 / 7e-61 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.006G230600 [exp] 189 / 3e-60 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.003G091700 [exp] 190 / 4e-60 AT4G17870 273 / 3e-94 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.012G000800 [exp] 183 / 1e-57 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 182 / 2e-57 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10022675 pacid=23178652 polypeptide=Lus10022675 locus=Lus10022675.g ID=Lus10022675.BGIv1.0 annot-version=v1.0 ATGCCTTCAAATCCTCCCAAATCCTCACTCCTACTCCACCGCATCACCGACACCACCACCGCCGCCATGGCGTGTCAGAAACAGCGGCGGTGTCCGCTTC CCCCCGCAGCCGCCGTCCCGGACGCGGCAGTAGCCCGGTACCACGACCACGCGGTGGGGCCCAACCAGTGCAGCTCCGCCGTGGTGCAGCAGATCGCCGC CCCTATCTCCACCGTGTGGTCGGTGCTGCGGAGGTTCGATAACCCGCAGGCGTACAAGCACTTCGTCAAGAGCTGCCACGTCATCCTCGGCACGGGCGAC GTCGGGTCTCTCCGTGAGGTCCACGTCATCTCCGGCCTTCCGGCTGCCAGCAGCACCGAGAGGCTCGAGATCCTCGATGAGGAGAGACACGTCATCAGCT TCAGCGTCGTGGGTGGGGACCACAGGCTGGCCAATTACCGTTCCGTCACCACACTACAGGCCGGCGGCGGCGGAGAGACGGTGGCGGTGGAGTCTTACGT GGTCGACGTTCCACCGGGGAACACGAAGGAGGACACGTGCGTGTTCGTCGACACGATCGTCCAGTGCAACCTTCAGTCGCTTGCTCAGATCGCCGAAAAT TCAGCTCGCCGGAGTAAAGCTGTATCGTCGGCTCCGACCAAATCATCGCGATCTGAACCTGCAATATCACCGGTGGCTTCTCGCGAATTTTCACAAGCGG AGACCACCATCTCTTCGACCGACACAACCCCAATAGATCTAACTGAAGACTCAGGGAGCAAGGCTGCAAGGAGGGGATCGGTGGATCACATAACCTGTCC GGAGGTTCTCATCCCTTTAGTCGAGGCACTTTCTCTCGCTGTGGTGGTGTAG
AA sequence Show only first row Show all	>Lus10022675 pacid=23178652 polypeptide=Lus10022675 locus=Lus10022675.g ID=Lus10022675.BGIv1.0 annot-version=v1.0 MPSNPPKSSLLLHRITDTTTAAMACQKQRRCPLPPAAAVPDAAVARYHDHAVGPNQCSSAVVQQIAAPISTVWSVLRRFDNPQAYKHFVKSCHVILGTGD VGSLREVHVISGLPAASSTERLEILDEERHVISFSVVGGDHRLANYRSVTTLQAGGGGETVAVESYVVDVPPGNTKEDTCVFVDTIVQCNLQSLAQIAEN SARRSKAVSSAPTKSSRSEPAISPVASREFSQAETTISSTDTTPIDLTEDSGSKAARRGSVDHITCPEVLIPLVEALSLAVVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10022675 [exp]	0	1
AT1G54340		ICDH	isocitrate dehydrogenase (.1)		Lus10012111 [exp]	1.7	0.8868
AT5G65210	bZIP	TGA1	bZIP transcription factor fami...		Lus10011445 [exp]	4.1	0.9059
AT2G31800			Integrin-linked protein kinase...		Lus10027107 [exp]	8.6	0.8954
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Lus10042104 [exp]	10.8	0.8835
AT4G35900	bZIP	ATBZIP14, FD-1,...	Basic-leucine zipper (bZIP) tr...		Lus10017283 [exp]	18.7	0.8716
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Lus10016410 [exp]	19.6	0.8285
AT2G32760			unknown protein		Lus10016662 [exp]	23.9	0.8805
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Lus10008910 [exp]	24.0	0.8000
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10026329 [exp]	26.6	0.8131
AT5G02270		ABCI20, ATNAP9	ARABIDOPSIS THALIANA NON-INTRI...		Lus10010838 [exp]	27.0	0.8733

Compare expression of checked genes

Lus10022675 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.