Lus10022680 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38360 214 / 3e-71 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT5G01640 187 / 8e-61 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT3G56110 165 / 4e-52 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT2G40380 163 / 2e-51 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G05380 163 / 3e-51 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT5G07110 152 / 7e-47 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT4G00005 110 / 7e-32 PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G08770 88 / 4e-22 PRA1.E prenylated RAB acceptor 1.E (.1)
AT3G13710 87 / 7e-22 PRA1.F4 prenylated RAB acceptor 1.F4 (.1)
AT3G13720 85 / 4e-21 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002853 236 / 8e-80 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10012224 226 / 5e-76 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 192 / 3e-62 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 191 / 4e-62 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10014234 181 / 4e-59 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 174 / 2e-55 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 172 / 1e-54 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 169 / 1e-53 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10005088 96 / 4e-25 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G126400 191 / 4e-62 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.006G104400 187 / 7e-61 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.010G183300 180 / 3e-58 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.019G124100 172 / 4e-55 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.008G074000 170 / 4e-54 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 170 / 4e-54 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.005G219100 109 / 2e-30 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G043800 101 / 2e-27 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 100 / 1e-26 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G044000 97 / 1e-25 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Lus10022680 pacid=23178511 polypeptide=Lus10022680 locus=Lus10022680.g ID=Lus10022680.BGIv1.0 annot-version=v1.0
ATGTCCGACCGATCCGCCTTCTCCAAGCCCGAATCCGTCTCGGAGGCCTCTCTCCGCCTCCGCAAGAACTACACTTACTTCCGCGTCAATTACATGGCCG
TCGTCGCCGCGATCGTCGCCTTCTCCTTGCTATCTCATCCGATCTCGCTCATGTTCCTCGTCGGCCTCCTCGCGTCCTGGATCTTCCTCTACCTGTTCCG
CCCCGCGGATCAACCGCTTGTGTTCTTCGGACGGAGCTTCACCGACATGGAGACGCTCGGGATCCTCGTCGTGTTCAGCGTTTTCGTCGTCTTCCTCACC
AACGTCGGATCCGTGCTCATCTCGGCAGTGATGCTCGGCTCGGCGGTCGTCTGTGCTCATGGATCGTTTAGGATTCCTGAGGATCTGTTCTTGGATGAGC
AGGAGCCGTCTGCAGCTACTGGATTCCTCTCGTTCCTTGGTGGTGCCGCGACGAATGTGGCTGCTACGACTGCTGCTCGCGTCTGA
AA sequence
>Lus10022680 pacid=23178511 polypeptide=Lus10022680 locus=Lus10022680.g ID=Lus10022680.BGIv1.0 annot-version=v1.0
MSDRSAFSKPESVSEASLRLRKNYTYFRVNYMAVVAAIVAFSLLSHPISLMFLVGLLASWIFLYLFRPADQPLVFFGRSFTDMETLGILVVFSVFVVFLT
NVGSVLISAVMLGSAVVCAHGSFRIPEDLFLDEQEPSAATGFLSFLGGAATNVAATTAARV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10022680 0 1
AT4G08810 SUB1 calcium ion binding (.1) Lus10039175 1.0 0.9762
AT1G17620 Late embryogenesis abundant (L... Lus10015622 2.4 0.9707
AT1G06780 GAUT6 galacturonosyltransferase 6 (.... Lus10024859 2.8 0.9619
AT2G20780 AtPLT4 Major facilitator superfamily ... Lus10031637 4.4 0.9547
AT1G48480 RKL1 receptor-like kinase 1 (.1) Lus10002299 5.2 0.9609
AT1G17620 Late embryogenesis abundant (L... Lus10037638 5.3 0.9625
AT3G55950 CCR3, ATCRR3 CRINKLY4 related 3 (.1) Lus10040663 5.5 0.9642
AT5G12890 UDP-Glycosyltransferase superf... Lus10031248 6.0 0.9566
AT1G19300 ATGATL1, GATL1,... PARVUS, GAOLAOZHUANGREN 1, GAL... Lus10010789 6.6 0.9657
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10014234 6.9 0.9605

Lus10022680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.