Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52590 122 / 1e-37 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G36170 122 / 1e-37 Ubiquitin supergroup;Ribosomal protein L40e (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008873 [exp] 124 / 2e-38 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10023236 [exp] 86 / 1e-23 AT3G52590 84 / 1e-22 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10014220 [exp] 79 / 8e-19 AT3G11510 236 / 4e-78 Ribosomal protein S11 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G077200 [exp] 122 / 1e-37 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.012G024300 [exp] 122 / 1e-37 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G007100 [exp] 122 / 1e-37 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.004G194000 [exp] 86 / 2e-23 AT3G52590 210 / 3e-71 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G077000 [exp] 70 / 2e-17 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01020 [flax] [poplar] Ribosomal_L40e Ribosomal L40e family
Representative CDS sequence Show only first row Show all	>Lus10022695 pacid=23178621 polypeptide=Lus10022695 locus=Lus10022695.g ID=Lus10022695.BGIv1.0 annot-version=v1.0 ATGCCAACACGGACCGAGTCGACTCTTCATCTTGTACTGAGGCTGAGGGGAGGAATCATCGAGCCTTCTTTGATGGCTTTGGCGCGCAAATACAATCAAG ATAAGATGATTTGCCGCAAATGCTACGCTCGTCTGCACCCAAGGGCTGTGAACTGCCGCAAGAAGAAATGTGGACACAGCAATCAGGTTAGCTGTTGTGT TGCGACAACAACTCATCAACGTGTGTGA
AA sequence Show only first row Show all	>Lus10022695 pacid=23178621 polypeptide=Lus10022695 locus=Lus10022695.g ID=Lus10022695.BGIv1.0 annot-version=v1.0 MPTRTESTLHLVLRLRGGIIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQVSCCVATTTHQRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36170			Ubiquitin supergroup;Ribosomal...		Lus10022695 [exp]	0	1
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10032257 [exp]	1.0	0.8685
AT5G14240			Thioredoxin superfamily protei...		Lus10014596 [exp]	7.2	0.8279
AT2G32170			S-adenosyl-L-methionine-depend...		Lus10035424 [exp]	64.5	0.7976
AT3G18520		HDA15, ATHDA15	histone deacetylase 15 (.1.2)		Lus10022906 [exp]	65.5	0.8203
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10025797 [exp]	65.7	0.7852
AT4G33110			S-adenosyl-L-methionine-depend...		Lus10022684 [exp]	66.7	0.8254
AT4G20150			unknown protein		Lus10036250 [exp]	73.8	0.8215
AT1G08125			S-adenosyl-L-methionine-depend...		Lus10021425 [exp]	74.6	0.8210
AT1G67420			Zn-dependent exopeptidases sup...		Lus10037015 [exp]	80.2	0.8081
AT1G44760			Adenine nucleotide alpha hydro...		Lus10025644 [exp]	86.1	0.8048

Compare expression of checked genes

Lus10022695 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.