Lus10022703 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11460 249 / 4e-79 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G33760 130 / 1e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G12770 126 / 5e-33 MEF22 mitochondrial editing factor 22 (.1)
AT3G16610 124 / 2e-32 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G77170 122 / 3e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14850 123 / 5e-32 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 119 / 2e-30 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39350 118 / 2e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G04370 118 / 3e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G08070 118 / 3e-30 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014211 429 / 2e-149 AT3G11460 791 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022702 311 / 5e-104 AT3G11460 641 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010320 136 / 7e-37 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10029436 127 / 2e-33 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10033858 126 / 3e-33 AT1G08070 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040648 124 / 2e-32 AT4G18750 376 / 1e-119 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018264 117 / 3e-31 AT3G12770 179 / 8e-51 mitochondrial editing factor 22 (.1)
Lus10008136 119 / 8e-31 AT5G39350 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020657 119 / 1e-30 AT1G77170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G211400 314 / 3e-104 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G152300 127 / 2e-33 AT4G33990 489 / 1e-162 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G322100 125 / 1e-32 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 124 / 2e-32 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G108000 123 / 4e-32 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.011G052300 122 / 8e-32 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G095100 120 / 4e-31 AT5G50390 865 / 0.0 EMBRYO DEFECTIVE 3141, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.017G001000 119 / 1e-30 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G006800 119 / 2e-30 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.003G088600 118 / 2e-30 AT1G31430 690 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10022703 pacid=23178531 polypeptide=Lus10022703 locus=Lus10022703.g ID=Lus10022703.BGIv1.0 annot-version=v1.0
ATGAAGTATTCAGAAATTTCCACAGTGACTTACAGGGTCACAACCACCGTCGTCGACTGGAGCCATCCATCATGGAACTCCCAGCTAAGAGAGCTAGCAA
ACAAATCCCTATTCTCAAACGCTCTGCATCTCTACCTCCGTATGCTCCGCTCCGGAGCAACTCCAAATGCGTTTACTTTCCCGTTCGTTCTCAAGTCCTC
CGCCGTCCTGTCTATCCCCTTCACCGGCGAGCATTGCCAAGCCACCAGAACAGGATGCTTGGAAGAACCTTTCGTCCAGACCGCATTGATATCCATGTAC
TCCAAATGCGGTTTACCAGATGGTGCACGTAAGGTGTTCGATGAAAATCCCCAGTCAAGAAAACTTACAGTTTGCTACAATGCTTTAATCGCCGGGTCCG
CCTTGAATACGAGAGTAAAGGATACCGTGTTGCTTTTTAATGAAATGAGGGGACTTGAAGTGCCGATCTATGGAGTCACCATGCTTGGAATTGTTCCTGT
TTGTGGAGTTCCAGGTAACTTGGGGCTTAGGGTTTCTGTGCATTGTTGTTGTCTGAAGTTTGGATTGAATTTGGACTCGTCAGTTGGGAATGGCTTGCTG
TCGATGTACTTGAGATGTGGAGAAATTGTTAGTGGACGGAAACTGTTCGATGAAATGCCAGAGAGAGGGTTGGTTACCTGGAACGCCATGATCAATGGCT
ATGCTTAG
AA sequence
>Lus10022703 pacid=23178531 polypeptide=Lus10022703 locus=Lus10022703.g ID=Lus10022703.BGIv1.0 annot-version=v1.0
MKYSEISTVTYRVTTTVVDWSHPSWNSQLRELANKSLFSNALHLYLRMLRSGATPNAFTFPFVLKSSAVLSIPFTGEHCQATRTGCLEEPFVQTALISMY
SKCGLPDGARKVFDENPQSRKLTVCYNALIAGSALNTRVKDTVLLFNEMRGLEVPIYGVTMLGIVPVCGVPGNLGLRVSVHCCCLKFGLNLDSSVGNGLL
SMYLRCGEIVSGRKLFDEMPERGLVTWNAMINGYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G11460 Pentatricopeptide repeat (PPR)... Lus10022703 0 1
AT1G06950 ATTIC110, TIC11... ARABIDOPSIS THALIANA TRANSLOCO... Lus10026424 2.8 0.9254
Lus10036489 4.2 0.9228
AT2G02750 Pentatricopeptide repeat (PPR)... Lus10030787 6.3 0.9210
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10035017 7.5 0.9167
AT4G31210 DNA topoisomerase, type IA, co... Lus10026991 8.1 0.9227
AT1G06950 ATTIC110, TIC11... ARABIDOPSIS THALIANA TRANSLOCO... Lus10042232 9.4 0.9160
AT1G16480 Tetratricopeptide repeat (TPR)... Lus10008829 9.5 0.9117
AT4G18130 PHYE phytochrome E (.1) Lus10004593 9.7 0.9194
AT3G03710 PDE326, PNP, RI... resistant to inhibition with F... Lus10001331 10.4 0.9179
AT3G04340 EMB2458 embryo defective 2458, FtsH ex... Lus10036490 11.2 0.9130

Lus10022703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.