Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52620 39 / 3e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021347 [exp] 54 / 1e-10 ND 35 / 0.001
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211600 [exp] 41 / 1e-05 AT3G52620 55 / 5e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022704 pacid=23178515 polypeptide=Lus10022704 locus=Lus10022704.g ID=Lus10022704.BGIv1.0 annot-version=v1.0 ATGACAGCAGTTCCAGAGAAGAAATCATTCCCAGAAGCAAATGTGGACAAAGAGCTGAATCCCGGCCACAACAAGACAGTCGAAGCCGATTCCACTTCCT CCCAAATCGCCGCCAACAAGGAGAAAGCGGAGGCTGAGAAGAAGAAAAGGTCGTCCGAGAAGAAGGAAGAGGACGGTGGGGATGGGATGAAGAAGACGGT CATTATGTCGGTCATCTTCGCCGCCGTTGCCGGTGCTGCGTTTGGCATCGCCAAGATGTTGAGAGAGAGGCGTTAA
AA sequence Show only first row Show all	>Lus10022704 pacid=23178515 polypeptide=Lus10022704 locus=Lus10022704.g ID=Lus10022704.BGIv1.0 annot-version=v1.0 MTAVPEKKSFPEANVDKELNPGHNKTVEADSTSSQIAANKEKAEAEKKKRSSEKKEEDGGDGMKKTVIMSVIFAAVAGAAFGIAKMLRERR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52620			unknown protein		Lus10022704 [exp]	0	1
AT1G09330		ECHIDNA, ECH	unknown protein		Lus10031433 [exp]	1.4	0.6606
					Lus10012774 [exp]	5.2	0.6622
AT1G10520		AtPol{lambda}	DNA polymerase {lambda}, DNA p...		Lus10007325 [exp]	6.7	0.6556
					Lus10039750 [exp]	12.3	0.6034
AT3G60630	GRAS	ATHAM2, LOM2	LOST MERISTEMS 2, ARABIDOPSIS ...		Lus10012237 [exp]	14.0	0.5855
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10040338 [exp]	14.1	0.6014
					Lus10010117 [exp]	15.5	0.6014
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025408 [exp]	16.7	0.6014
					Lus10005187 [exp]	17.9	0.6014
					Lus10002152 [exp]	19.0	0.6014

Compare expression of checked genes

Lus10022704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.