Lus10022705 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18590 147 / 2e-47 Nucleic acid-binding, OB-fold-like protein (.1)
AT3G52630 142 / 2e-45 Nucleic acid-binding, OB-fold-like protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014209 217 / 6e-75 AT4G18590 151 / 4e-49 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10014210 211 / 3e-72 AT4G18590 143 / 2e-45 Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G211900 176 / 6e-59 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2)
Potri.006G212100 176 / 6e-59 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2)
Potri.010G239200 133 / 1e-41 AT4G18590 135 / 1e-42 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF08661 Rep_fac-A_3 Replication factor A protein 3
Representative CDS sequence
>Lus10022705 pacid=23178592 polypeptide=Lus10022705 locus=Lus10022705.g ID=Lus10022705.BGIv1.0 annot-version=v1.0
ATGGACACATCGAACCCTGCGATTTTCGTCAACGGCGCCCTCCTGCCGATGCATCTGCGGAAGAGAGTCAGGACTGTGATCCAAGTAATTCGATCCGAGC
TCGGATCAGTCGTCGGGAAAACCACAGATGAGCAACAGATAGTAATCAAGGGCTCCCCGCCGCATGAATCCCAACCTCTCACTACCTTCGTTGAAGTCAT
CGGCATTGCAGACTCTGAGAAGTCCATCCAGGCTGAGATATGGACCAACTTCGGCAATGAAGCCGACGCCTACTCCTTCAATCAGCTTTGCCAACTTGCA
AATGGTGAATACAAACAATTGTTCCTCTGA
AA sequence
>Lus10022705 pacid=23178592 polypeptide=Lus10022705 locus=Lus10022705.g ID=Lus10022705.BGIv1.0 annot-version=v1.0
MDTSNPAIFVNGALLPMHLRKRVRTVIQVIRSELGSVVGKTTDEQQIVIKGSPPHESQPLTTFVEVIGIADSEKSIQAEIWTNFGNEADAYSFNQLCQLA
NGEYKQLFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18590 Nucleic acid-binding, OB-fold-... Lus10022705 0 1
AT3G10520 ATGLB2, ARATHGL... NON-SYMBIOTIC HAEMOGLOBIN 2, A... Lus10038655 1.0 0.9843
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10023601 1.7 0.9635
Lus10001343 2.0 0.9675
AT3G19000 2-oxoglutarate (2OG) and Fe(II... Lus10024230 2.0 0.9384
AT1G01420 UGT72B3 UDP-glucosyl transferase 72B3 ... Lus10005334 2.8 0.9074
AT5G01740 Nuclear transport factor 2 (NT... Lus10001261 3.5 0.8416
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10033564 3.5 0.9314
AT4G21520 Transducin/WD40 repeat-like su... Lus10002602 3.6 0.8398
AT2G44060 Late embryogenesis abundant pr... Lus10019367 3.7 0.9308
AT4G26690 GDPDL3, GPDL2, ... SHAVEN 3, MUTANT ROOT HAIR 5, ... Lus10043171 4.5 0.8580

Lus10022705 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.