Plant FIBer expression Database

Lus10022716 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52730 95 / 9e-28 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014198
[exp]
121 / 2e-38 AT3G52730 94 / 2e-27 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10021364
[exp]
115 / 5e-36 AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10017043
[exp]
115 / 5e-36 AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G188700
[exp]
92 / 1e-26 AT3G52730 122 / 2e-38 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Potri.009G149300
[exp]
91 / 2e-26 AT3G52730 117 / 2e-36 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Representative CDS sequence
>Lus10022716 pacid=23178514 polypeptide=Lus10022716 locus=Lus10022716.g ID=Lus10022716.BGIv1.0 annot-version=v1.0
ATGGAGTACGTACCGAGGAGGACTCAAGGTGGCCTTTTTGAAGGCATCTACAAGGTTTTCATGCGCCGTACCTCCGTCTACGCCACCTTCGTCCTCGCCG
GTGCTTTCTTCGGTGAACGGGCCGTGGATTATGGTGTTCATAAGCTGTGGGAGCACAACAATGTTGGGGTACTTCTCTAG
AA sequence
>Lus10022716 pacid=23178514 polypeptide=Lus10022716 locus=Lus10022716.g ID=Lus10022716.BGIv1.0 annot-version=v1.0
MEYVPRRTQGGLFEGIYKVFMRRTSVYATFVLAGAFFGERAVDYGVHKLWEHNNVGVLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52730 ubiquinol-cytochrome C reducta... Lus10022716
[exp]
0 1
AT5G44200 ATCBP20, CBP20 CAP-binding protein 20 (.1.2) Lus10039887
[exp]
7.1 0.8037
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10039147
[exp]
10.4 0.7822
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10041296
[exp]
12.6 0.7419
AT4G14615 unknown protein Lus10041178
[exp]
14.7 0.7577
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10002339
[exp]
15.3 0.7570
AT1G16000 unknown protein Lus10011478
[exp]
15.9 0.7508
AT2G31490 unknown protein Lus10027603
[exp]
19.8 0.7453
AT2G31140 Peptidase S24/S26A/S26B/S26C f... Lus10022921
[exp]
21.4 0.7698
AT5G27430 Signal peptidase subunit (.1) Lus10040138
[exp]
25.2 0.7561
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10004885
[exp]
28.3 0.7157

Lus10022716 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.