Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014196 [exp] 0 / 1 AT3G52750 569 / 0.0 Tubulin/FtsZ family protein (.1) Lus10021367 [exp] 0 / 1 AT3G52750 607 / 0.0 Tubulin/FtsZ family protein (.1) Lus10017047 [exp] 0 / 1 AT2G36250 597 / 0.0 Tubulin/FtsZ family protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022719 pacid=23178586 polypeptide=Lus10022719 locus=Lus10022719.g ID=Lus10022719.BGIv1.0 annot-version=v1.0 ATGGCTTTCGTTTTGCCCTCCGATACAAGAAACCCCGCCGGAATCTTGACGGTTCTAGGTGGCGGGAGGACATCCGGCAGCTCCTCCGTTAAACTCTCTG AGTTCAGGAATAGGCTTCTTGCTGCTAGTCAGAGGTCGCACTTCCCTTCAGTGAGATGCTCGGCGAGCAATCGTAATGTAACGGAGGCTTCCGTCGGTCT GCGTCCCGAAGTTTCGCCGCGCAGAGGTGAAGGGAATAGTAGTTCAGTTTTGGCCCCGAGAAGGATTCTCCAAGTGTTGATATCACGGAGAGTTTGGTGG ATCAGTCTACTGCTCCCAGTGATTATTTTGGAGCTAAGATCAAAGTGGTTGGTGTTGGAGGTGGTGGATCGAATGCAGTCAATCGTATGA
AA sequence Show only first row Show all	>Lus10022719 pacid=23178586 polypeptide=Lus10022719 locus=Lus10022719.g ID=Lus10022719.BGIv1.0 annot-version=v1.0 MAFVLPSDTRNPAGILTVLGGGRTSGSSSVKLSEFRNRLLAASQRSHFPSVRCSASNRNVTEASVGLRPEVSPRRGEGNSSSVLAPRRILQVLISRRVWW ISLLLPVIILELRSKWLVLEVVDRMQSIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022719 [exp]	0	1
AT3G52750		FTSZ2-2	Tubulin/FtsZ family protein (....		Lus10022718 [exp]	1.0	0.7663
					Lus10036680 [exp]	25.2	0.7047
AT5G11030		ALF4	aberrant lateral root formatio...		Lus10006197 [exp]	28.3	0.7470
AT3G57570			ARM repeat superfamily protein...		Lus10026305 [exp]	37.1	0.6734
AT1G20230			Pentatricopeptide repeat (PPR)...		Lus10006815 [exp]	56.7	0.7179
AT3G17740			unknown protein		Lus10031899 [exp]	63.6	0.7026
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Lus10003427 [exp]	84.7	0.7129
					Lus10019215 [exp]	95.5	0.7107
AT1G69290			Pentatricopeptide repeat (PPR)...		Lus10036907 [exp]	144.5	0.6836
AT5G20320		DCL4, ATDCL4	dicer-like 4 (.1.2)		Lus10040013 [exp]	196.5	0.6766

Compare expression of checked genes

Lus10022719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.