Lus10022726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 303 / 5e-108 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G41700 300 / 7e-107 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT4G27960 300 / 9e-107 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G53300 299 / 3e-106 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT3G08690 293 / 4e-104 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 281 / 5e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 278 / 7e-98 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 254 / 2e-88 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 167 / 1e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 152 / 5e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014187 308 / 1e-109 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 302 / 3e-107 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 301 / 7e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 301 / 7e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 299 / 5e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 299 / 5e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 296 / 7e-105 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10033937 293 / 6e-104 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10027846 288 / 1e-101 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G110200 303 / 7e-108 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 301 / 3e-107 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.016G138900 301 / 3e-107 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 301 / 6e-107 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.001G094900 300 / 1e-106 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 298 / 4e-106 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 298 / 4e-106 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.011G168200 292 / 1e-103 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 290 / 7e-103 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 289 / 2e-102 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10022726 pacid=23178538 polypeptide=Lus10022726 locus=Lus10022726.g ID=Lus10022726.BGIv1.0 annot-version=v1.0
ATGGCTTCCAAGCGTATCTTGAAGGAACTCAAGGATCTGCAGAAGGATCCTCCCAGCTCCTGCAGCGCAGGCCCTGTAGCGGAGGACATGTTCCACTGGC
AAGCAACGATTATGGGTCCTTCAGATAGTCCCTATTCTGGAGGTGTTTTCCTGGTTACGATTCACTTTCCTCCAGATTATCCTTTCAAGCCACCCAAGGT
AGCGTTTAGGACCAAGGTCTTCCACCCTAATGTCAACAGCAATGGAAGCATTTGTCTTGATATCCTGAAAGAGCAGTGGAGTCCAGCTCTTACGATCTCA
AAGGTACTGCTCTCGATTTGCTCCTTGTTGACGGATCCCAATCCCGATGACCCTTTGGTGCCAGAGATAGCACACATGTACAAGGTCGACCGCTCCAAGT
ACGAGGCTACTGCACGCAGCTGGACCCAAAAGTATGCCATGGGATGA
AA sequence
>Lus10022726 pacid=23178538 polypeptide=Lus10022726 locus=Lus10022726.g ID=Lus10022726.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPSSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKVDRSKYEATARSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10022726 0 1
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Lus10030810 1.7 0.9545
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Lus10013287 2.4 0.9473
AT4G35470 PIRL4, DREB1C plant intracellular ras group-... Lus10004559 3.2 0.9372
AT3G07560 APM2, PEX13 ABERRANT PEROXISOME MORPHOLOGY... Lus10012306 4.2 0.9480
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10021909 6.0 0.9268
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10023430 7.2 0.9159
AT2G12646 PLATZ transcription factor fam... Lus10008031 8.4 0.9282
AT3G15760 unknown protein Lus10030098 8.9 0.9374
AT3G21865 PEX22 peroxin 22 (.1) Lus10015100 9.4 0.9272
AT5G26990 Drought-responsive family prot... Lus10031467 11.2 0.9219

Lus10022726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.