Lus10022729 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01930 276 / 4e-92 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
AT5G66460 199 / 2e-62 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
AT3G10900 193 / 2e-60 Glycosyl hydrolase superfamily protein (.1)
AT3G10890 191 / 2e-59 Glycosyl hydrolase superfamily protein (.1)
AT4G28320 190 / 6e-59 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1)
AT2G20680 186 / 2e-57 MAN2, AtMAN2 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
AT1G02310 165 / 2e-49 MAN1 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1)
AT3G30540 124 / 1e-34 Glycosyl hydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014184 320 / 2e-109 AT5G01930 674 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Lus10014288 201 / 6e-63 AT5G66460 583 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10007900 201 / 1e-62 AT5G66460 417 / 4e-143 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10030347 198 / 1e-61 AT5G66460 422 / 2e-145 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10007210 197 / 1e-61 AT5G66460 401 / 5e-138 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10025995 202 / 2e-61 AT5G66460 577 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10039833 196 / 6e-61 AT2G20680 633 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Lus10007211 200 / 7e-60 AT1G02310 405 / 4e-134 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1)
Lus10031650 192 / 9e-60 AT2G20680 655 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G138600 302 / 5e-102 AT5G01930 683 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Potri.006G109900 300 / 1e-100 AT5G01930 659 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Potri.007G022000 214 / 5e-68 AT5G66460 573 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.005G120500 211 / 6e-67 AT5G66460 588 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.005G229600 195 / 6e-61 AT5G66460 542 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.013G130400 195 / 1e-60 AT2G20680 661 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Potri.002G184500 189 / 9e-59 AT5G66460 447 / 5e-156 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.006G009400 184 / 3e-56 AT4G28320 430 / 2e-148 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1)
Potri.019G070200 137 / 2e-39 AT3G10890 302 / 3e-100 Glycosyl hydrolase superfamily protein (.1)
Potri.016G014801 59 / 8e-11 AT2G20680 231 / 2e-74 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Representative CDS sequence
>Lus10022729 pacid=23178609 polypeptide=Lus10022729 locus=Lus10022729.g ID=Lus10022729.BGIv1.0 annot-version=v1.0
ATGAGAGATGGTTGCAAACAAAGGGAACCAATTTGTGCTGAAGGATCAACCATTCTATGTCATTGGCTTCAACACTTACTGGCTGATGGTATTGTATTAT
CTGCCGATCAATCGACCCGGACAAAGGTCTCTCAGCTCTTCCAGCAGGCTTCCTCGGTGGGATTCACTGTCTGCAGGACATGGGCGTTCAACGATGGACA
ATATCGCTCACTTCAGAAATCCCCCGGTGTCTATGATGAGGACGTTTTCAAGGCATTGGATTTCGTGGTGAGCGAAGCCAAGAAGTACAAGATCAGACTG
ATACTGTCCCTCCCCAATAACTGGGATGCCTATGGTGGAAAAGCTCAGTATGTCAAGTGGGGGAAGGAAGCAGGATTCAATCTCACCTCCGACGACGACT
TCTTCTCCCACCCGACACTCAGATCCTACTACAAAGCTCACGTCAAGATGGTGCTGAACCGAGTCAACACCATCACAAATGTGACATACAAGGAAGACCC
GACAGTCTTCGCATGGGAGTTGATGAACGAGCCTCGCTGCACCTCTGACCCTTCGGGAGACAAGCTTCAGGTTTGCGAGTAG
AA sequence
>Lus10022729 pacid=23178609 polypeptide=Lus10022729 locus=Lus10022729.g ID=Lus10022729.BGIv1.0 annot-version=v1.0
MRDGCKQREPICAEGSTILCHWLQHLLADGIVLSADQSTRTKVSQLFQQASSVGFTVCRTWAFNDGQYRSLQKSPGVYDEDVFKALDFVVSEAKKYKIRL
ILSLPNNWDAYGGKAQYVKWGKEAGFNLTSDDDFFSHPTLRSYYKAHVKMVLNRVNTITNVTYKEDPTVFAWELMNEPRCTSDPSGDKLQVCE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G01930 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl ... Lus10022729 0 1
Lus10001533 1.0 0.9772
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Lus10042371 1.4 0.9681
AT4G34410 AP2_ERF RRTF1 (Redox Re... redox responsive transcription... Lus10014054 2.8 0.9565
AT3G49210 O-acyltransferase (WSD1-like) ... Lus10033680 3.0 0.9587
AT3G11910 AtUBP13, UBP13 ubiquitin-specific protease 13... Lus10013550 3.3 0.9360
AT1G68390 Core-2/I-branching beta-1,6-N-... Lus10031958 3.9 0.9515
AT1G56140 Leucine-rich repeat transmembr... Lus10031777 4.2 0.9503
AT5G51990 AP2_ERF CBF4, DREB1D DEHYDRATION-RESPONSIVE ELEMENT... Lus10027412 4.5 0.9377
AT4G28380 Leucine-rich repeat (LRR) fami... Lus10017713 4.9 0.9353
AT1G54520 unknown protein Lus10006109 5.5 0.9246

Lus10022729 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.