Lus10022743 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01880 122 / 1e-35 RING/U-box superfamily protein (.1)
AT3G10910 110 / 1e-30 RING/U-box superfamily protein (.1)
AT1G49230 98 / 2e-25 RING/U-box superfamily protein (.1)
AT5G05280 96 / 7e-25 RING/U-box superfamily protein (.1)
AT1G49220 85 / 3e-20 RING/U-box superfamily protein (.1)
AT5G47610 83 / 3e-20 RING/U-box superfamily protein (.1)
AT1G49210 83 / 8e-20 RING/U-box superfamily protein (.1)
AT2G17450 82 / 9e-20 RHA3A RING-H2 finger A3A (.1)
AT4G35480 81 / 5e-19 RHA3B RING-H2 finger A3B (.1)
AT3G18773 81 / 9e-19 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025146 118 / 8e-34 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1)
Lus10029037 117 / 1e-33 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10006785 100 / 3e-26 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
Lus10005817 100 / 6e-26 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1)
Lus10006787 98 / 2e-25 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1)
Lus10033515 98 / 5e-25 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
Lus10005816 97 / 6e-25 AT1G49230 169 / 5e-53 RING/U-box superfamily protein (.1)
Lus10006788 97 / 9e-25 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1)
Lus10005814 96 / 9e-25 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G136200 137 / 3e-41 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.013G091300 112 / 2e-31 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.019G057700 107 / 2e-29 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.019G130100 102 / 2e-27 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.019G010500 102 / 4e-27 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.001G309600 102 / 5e-27 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.013G157000 96 / 4e-25 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1)
Potri.001G309700 91 / 1e-22 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.003G075200 87 / 1e-21 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Potri.005G099000 86 / 5e-21 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10022743 pacid=23178643 polypeptide=Lus10022743 locus=Lus10022743.g ID=Lus10022743.BGIv1.0 annot-version=v1.0
ATGACGCGGATCCTGCTCCACTCCTCGGCATTCAGTTCGCCGCCACCGCCGTCGAATGCGGCGGCTAATTCAACCAACGCAACAACACCAACCTCCCACG
ATCCGTACATCAACGAGAGGGATTTCGACGCCAACATGGTGATTATACTCGCCGCCTTGCTCTGCGCGCTGATCGGCGCTCTGGGTCTGAACTCAATCGT
CCGCTGCGCGATGAGGTGCGGCACATCCCCGCCGGCGATGGGGGCGGGGCAGGCTTCGGCGGCGTCGAAGAAGGGTTTGAAAAAGCGGGATCTGAAGCAG
ATCCCTGTCGCTGTGTATGGTTCCGGGGAGGAAGGAATGCCACCGGTGACGGAGTGCTCAATCTGTCTAGGTGAGTTCACAGACGGGGAGAAAGTTCGGG
TCTTGCCCAAGTGTAATCATGGGTTCCATGTGGAGTGCGTCGATAAATGGCTGCAGTCTCGCTCTTCCTGCCCTAATTGCCGGATGGATCCCAGAGATCG
GCGAGGTTCCGGCGCCGGCGGTGGTTGTAATAATGTCGATGTAGTTGTTGAATCGACGTGA
AA sequence
>Lus10022743 pacid=23178643 polypeptide=Lus10022743 locus=Lus10022743.g ID=Lus10022743.BGIv1.0 annot-version=v1.0
MTRILLHSSAFSSPPPPSNAAANSTNATTPTSHDPYINERDFDANMVIILAALLCALIGALGLNSIVRCAMRCGTSPPAMGAGQASAASKKGLKKRDLKQ
IPVAVYGSGEEGMPPVTECSICLGEFTDGEKVRVLPKCNHGFHVECVDKWLQSRSSCPNCRMDPRDRRGSGAGGGCNNVDVVVEST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10910 RING/U-box superfamily protein... Lus10022743 0 1
AT1G30700 FAD-binding Berberine family p... Lus10038439 2.2 0.8327
AT3G46200 ATNUDT9 nudix hydrolase homolog 9 (.1) Lus10005433 3.5 0.8499
AT3G61580 AtSLD1 sphingoid LCB desaturase 1, Fa... Lus10035482 4.4 0.8585
AT4G34530 bHLH bHLH063, CIB1 cryptochrome-interacting basic... Lus10040448 5.5 0.8401
AT4G33625 unknown protein Lus10007070 6.0 0.8371
AT5G20500 Glutaredoxin family protein (.... Lus10021590 7.7 0.8069
AT3G59680 unknown protein Lus10025594 8.1 0.8164
AT5G59800 ATMBD7, MBD7 ARABIDOPSIS THALIANA METHYL-CP... Lus10005888 11.4 0.8186
AT4G29310 Protein of unknown function (D... Lus10012933 12.0 0.8091
AT2G34560 P-loop containing nucleoside t... Lus10038499 16.7 0.8193

Lus10022743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.