Lus10022758 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08820 185 / 7e-55 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33170 156 / 6e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21065 149 / 1e-42 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G48910 151 / 2e-42 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G29760 149 / 2e-41 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49142 149 / 2e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G62890 147 / 2e-41 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G09950 149 / 3e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33990 146 / 2e-40 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G30700 145 / 3e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029436 258 / 2e-82 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040577 154 / 5e-45 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020588 150 / 8e-45 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016387 152 / 2e-43 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004892 154 / 7e-43 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015414 152 / 2e-42 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010909 151 / 2e-42 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000110 145 / 2e-42 AT4G37380 413 / 9e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018223 151 / 4e-42 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G105700 224 / 1e-69 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G128900 221 / 3e-68 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G018700 159 / 8e-45 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G040100 158 / 1e-44 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G184800 158 / 1e-44 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G239600 156 / 2e-44 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G044700 155 / 7e-44 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G011000 155 / 9e-44 AT1G08070 572 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G031600 153 / 4e-43 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G354400 153 / 4e-43 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10022758 pacid=23178656 polypeptide=Lus10022758 locus=Lus10022758.g ID=Lus10022758.BGIv1.0 annot-version=v1.0
ATGATCCGCGGGTTAGTCTCCAACGACTGCTTCACAGACGCAATCTCATTCTACGCTTCGATGAGAAGAGAAGGATTCTCCCCTACAGGATTCACTTTCC
CTTTCGTTGTCAAAGCATGCGCCAGGAGCTTGGATTTGAGTTTCGGATTGGAGCTTCATTCCCAGGTGGTGAAATTCGGATTCGTATCCTACGTGTTCGT
GAACACCAGTTTGGTGAGCTTGTACGCGAAATGTGGGTTTATTGATGATGCCGACGGGGTCGTTCACGAGTTTCTCGTCGGAGACACGTCCAACCCTTTA
TCGGAGACCATATATTCCAAGCTCTCCGAATTGGCCAAGGATTTGCCGGCTGCGGGGTATGTTCCTACCACGGAGTATATACTGTTTGATATAGAAGAGG
AAGAGAAGGAGCATTTCCTCGGGTGCCATAGCGAAAAGCTCGCAGTTGCTTTCGGGCTAATAGCCATGGGTCCCATGGACGTGATCCGGGTGGTGAAGAA
CCTCAGGATTTGTGGCGATTGCCATGAGGCTATCAAGGTGATTTCTCGAGTTACGGGTAGCGAGATAGTTGTTAGAGATACTAATCGCTTTCATTGTTTC
TCTGGCGGAACATGTTCTTGTAACGATTACTGGTGA
AA sequence
>Lus10022758 pacid=23178656 polypeptide=Lus10022758 locus=Lus10022758.g ID=Lus10022758.BGIv1.0 annot-version=v1.0
MIRGLVSNDCFTDAISFYASMRREGFSPTGFTFPFVVKACARSLDLSFGLELHSQVVKFGFVSYVFVNTSLVSLYAKCGFIDDADGVVHEFLVGDTSNPL
SETIYSKLSELAKDLPAAGYVPTTEYILFDIEEEEKEHFLGCHSEKLAVAFGLIAMGPMDVIRVVKNLRICGDCHEAIKVISRVTGSEIVVRDTNRFHCF
SGGTCSCNDYW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08820 Pentatricopeptide repeat (PPR)... Lus10022758 0 1
AT2G44830 Protein kinase superfamily pro... Lus10028208 6.6 0.7992
AT1G74900 OTP43 organelle transcript processin... Lus10042307 7.7 0.7641
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10019694 10.6 0.7877
AT4G03415 Protein phosphatase 2C family ... Lus10039802 11.7 0.7825
AT1G15215 SHH1, DTF1 SAWADEE homeodomain homolog 1,... Lus10038276 12.5 0.7417
AT1G52140 unknown protein Lus10037566 14.8 0.7428
AT3G51650 unknown protein Lus10009100 15.3 0.7498
AT1G05070 Protein of unknown function (D... Lus10020038 17.8 0.7551
AT3G06270 Protein phosphatase 2C family ... Lus10034009 18.7 0.7025
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10011900 20.0 0.7280

Lus10022758 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.