Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26510 49 / 5e-08 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) AT3G18230 45 / 3e-06 Octicosapeptide/Phox/Bem1p family protein (.1) AT3G48240 41 / 3e-05 Octicosapeptide/Phox/Bem1p family protein (.1) AT2G01190 40 / 0.0001 PDE331 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008047 [exp] 100 / 2e-28 AT1G70640 43 / 2e-05 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1) Lus10010073 [exp] 107 / 6e-28 AT1G64260 155 / 3e-39 MuDR family transposase (.1) Lus10038115 [exp] 99 / 1e-27 AT1G70640 45 / 3e-06 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1) Lus10035641 [exp] 52 / 8e-09 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10010753 [exp] 49 / 4e-08 AT5G09620 182 / 5e-56 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10042925 [exp] 49 / 1e-07 AT5G09620 236 / 7e-72 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10034643 [exp] 41 / 7e-05 AT2G01190 186 / 1e-53 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1) Lus10018412 [exp] 39 / 0.0003 AT4G05150 304 / 1e-98 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10035772 [exp] 39 / 0.0003 AT5G49920 196 / 2e-60 Octicosapeptide/Phox/Bem1p family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G285800 [exp] 50 / 6e-08 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.011G041100 [exp] 47 / 5e-07 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.002G108800 [exp] 47 / 6e-07 AT5G09620 146 / 3e-39 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.009G080200 [exp] 45 / 2e-06 AT5G64430 281 / 6e-89 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.004G032200 [exp] 45 / 3e-06 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.001G052000 [exp] 42 / 2e-05 AT1G04700 721 / 0.0 PB1 domain-containing protein tyrosine kinase (.1) Potri.003G176100 [exp] 42 / 3e-05 AT1G04700 725 / 0.0 PB1 domain-containing protein tyrosine kinase (.1) Potri.012G053500 [exp] 40 / 0.0002 AT3G18230 298 / 6e-92 Octicosapeptide/Phox/Bem1p family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00564 [flax] [poplar] PB1 PB1 domain
Representative CDS sequence Show only first row Show all	>Lus10022759 pacid=23178598 polypeptide=Lus10022759 locus=Lus10022759.g ID=Lus10022759.BGIv1.0 annot-version=v1.0 ATGGCAATAGCAGGGGTGAAGACGATTGCAATATGTCAGCTGGGAGGAGAATTCCACACCGACCACGACGGATCCTTGTCCTACAGAGGCGGAGACGCTC ACGCAATCGACATCGACGATCAATTACAGTTCGCCGACTTCAAAATGGAGGTCGCCGAGATGTTCAACTGCGGCGGAATCAATTCCATGTCGCTCAAGTA CTTCCTCCCTGGTAATCTAAAGACTCTCATCACCATCTCCAACGACAAGGACTTCCACCGCATGCTCCGTTTCCATTCCAATTCCCTCACCATTGATGTC TATGTCTTCCTCAACCAGGAATCGCTACCCGACTTCTCCAGCTTCCCCGCCAGCCGGTAA
AA sequence Show only first row Show all	>Lus10022759 pacid=23178598 polypeptide=Lus10022759 locus=Lus10022759.g ID=Lus10022759.BGIv1.0 annot-version=v1.0 MAIAGVKTIAICQLGGEFHTDHDGSLSYRGGDAHAIDIDDQLQFADFKMEVAEMFNCGGINSMSLKYFLPGNLKTLITISNDKDFHRMLRFHSNSLTIDV YVFLNQESLPDFSSFPASR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70640			octicosapeptide/Phox/Bem1p (PB...		Lus10022759 [exp]	0	1
AT5G47820		FRA1	FRAGILE FIBER 1, P-loop contai...		Lus10010047 [exp]	1.7	0.8694
AT1G13190			RNA-binding (RRM/RBD/RNP motif...		Lus10038759 [exp]	16.9	0.8148
AT3G54440			glycoside hydrolase family 2 p...		Lus10039520 [exp]	16.9	0.8543
AT1G21630			Calcium-binding EF hand family...		Lus10035983 [exp]	21.7	0.8530
AT2G47500			P-loop nucleoside triphosphate...		Lus10010302 [exp]	22.0	0.8321
AT5G53480			ARM repeat superfamily protein...		Lus10023246 [exp]	23.8	0.8380
AT3G17920			Outer arm dynein light chain 1...		Lus10041989 [exp]	29.6	0.7961
AT3G48050		SUO	'shuttle' in chinese, BAH doma...		Lus10042137 [exp]	32.8	0.8378
AT3G61130		GAUT1, LGT1	galacturonosyltransferase 1 (....		Lus10041389 [exp]	34.3	0.8012
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Lus10038725 [exp]	40.3	0.8073

Compare expression of checked genes

Lus10022759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.