Plant FIBer expression Database

Lus10022770 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48140 150 / 3e-49 DPMS3 dolichol phosphate mannose synthase 3, dolichol-phosphate mannosyltransferase-related (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011837
[exp]
177 / 8e-60 AT1G48140 151 / 1e-49 dolichol phosphate mannose synthase 3, dolichol-phosphate mannosyltransferase-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G245800
[exp]
145 / 9e-47 AT1G48140 155 / 1e-50 dolichol phosphate mannose synthase 3, dolichol-phosphate mannosyltransferase-related (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08285 DPM3 Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)
Representative CDS sequence
>Lus10022770 pacid=23160012 polypeptide=Lus10022770 locus=Lus10022770.g ID=Lus10022770.BGIv1.0 annot-version=v1.0
ATGAAGCATATATTCAAGATTCTGGCATTGGTGGCTGCCATTGCTGCCTTTTGGGTTGGTCTCTTGCAGGCATCCGTGATTCCCCGTACACATACTTGGT
TGCTGCCGGTTTATCTTATTGTGTCATTGGGATGCTATGGCTTACTCATGGTTGGAGTAGGATTATTGAAGTTCCCAACTTGTCCTCATGAGGCAGTGCT
GTTACAGCAGGACATTACTGAGGCAAAAGGGTTCCTGAAGGAGAAAGGAGTTGATGTTGGTTCAGAATGA
AA sequence
>Lus10022770 pacid=23160012 polypeptide=Lus10022770 locus=Lus10022770.g ID=Lus10022770.BGIv1.0 annot-version=v1.0
MKHIFKILALVAAIAAFWVGLLQASVIPRTHTWLLPVYLIVSLGCYGLLMVGVGLLKFPTCPHEAVLLQQDITEAKGFLKEKGVDVGSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48140 DPMS3 dolichol phosphate mannose syn... Lus10022770
[exp]
0 1
AT5G41670 6-phosphogluconate dehydrogena... Lus10032341
[exp]
8.4 0.8840
AT2G45010 PLAC8 family protein (.1.2) Lus10027214
[exp]
8.5 0.8580
AT1G17530 ATTIM23-1 translocase of inner mitochond... Lus10008470
[exp]
9.1 0.8843
AT4G04950 AtGRXS17 Arabidopsis thaliana monothiol... Lus10018487
[exp]
9.8 0.8744
AT2G30050 transducin family protein / WD... Lus10037571
[exp]
15.0 0.8700
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10005064
[exp]
17.1 0.8668
AT1G29260 PEX7, ATPEX7 ARABIDOPSIS PEROXIN 7, peroxin... Lus10007274
[exp]
18.1 0.8609
AT3G11330 PIRL9 plant intracellular ras group-... Lus10013689
[exp]
24.5 0.8507
AT3G11330 PIRL9 plant intracellular ras group-... Lus10017948
[exp]
26.1 0.8426
AT5G41670 6-phosphogluconate dehydrogena... Lus10024725
[exp]
27.4 0.8705

Lus10022770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.