Lus10022780 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07170 219 / 4e-73 Sterile alpha motif (SAM) domain-containing protein (.1)
AT5G48680 171 / 5e-54 Sterile alpha motif (SAM) domain-containing protein (.1)
AT1G70180 71 / 1e-14 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
AT2G45700 49 / 8e-07 sterile alpha motif (SAM) domain-containing protein (.1)
AT3G48800 44 / 2e-05 Sterile alpha motif (SAM) domain-containing protein (.1)
AT5G23680 44 / 2e-05 Sterile alpha motif (SAM) domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011841 362 / 9e-126 AT3G07170 196 / 9e-61 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10038185 291 / 2e-101 AT3G07170 234 / 9e-79 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10025917 179 / 5e-58 AT3G07170 157 / 3e-49 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10014516 85 / 1e-19 AT1G70180 80 / 1e-16 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10030825 60 / 1e-10 AT1G70180 104 / 8e-25 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10030661 57 / 1e-09 AT1G70180 102 / 6e-24 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10038078 50 / 2e-07 AT2G45700 767 / 0.0 sterile alpha motif (SAM) domain-containing protein (.1)
Lus10016718 40 / 0.0005 AT5G23680 173 / 6e-52 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10036012 40 / 0.0006 AT5G23680 171 / 4e-51 Sterile alpha motif (SAM) domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G244700 273 / 4e-94 AT3G07170 213 / 1e-70 Sterile alpha motif (SAM) domain-containing protein (.1)
Potri.014G190800 267 / 6e-92 AT3G07170 218 / 1e-72 Sterile alpha motif (SAM) domain-containing protein (.1)
Potri.008G193300 77 / 1e-16 AT1G70180 122 / 3e-31 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Potri.010G036500 75 / 5e-16 AT1G70180 134 / 1e-35 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Potri.006G218300 47 / 3e-06 AT2G45700 732 / 0.0 sterile alpha motif (SAM) domain-containing protein (.1)
Potri.012G104700 45 / 2e-05 AT3G48800 166 / 2e-49 Sterile alpha motif (SAM) domain-containing protein (.1)
Potri.015G104000 44 / 4e-05 AT3G48800 115 / 5e-30 Sterile alpha motif (SAM) domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0003 SAM PF00536 SAM_1 SAM domain (Sterile alpha motif)
Representative CDS sequence
>Lus10022780 pacid=23160027 polypeptide=Lus10022780 locus=Lus10022780.g ID=Lus10022780.BGIv1.0 annot-version=v1.0
ATGTATGCTGATCGAGTTGAAGTCTCGGGGAAGATGTCCGTCAAGGAGCGTCTCAATGGAAGCTCTCTCGGCGACTCGTCTCGCCGGAAACAAGTCACCG
GTAAAAGGCAAAGGCAAGATGACAAGTGGGAGCACGATCTCTACAATAACGAACCGCGTACTTCAAACCGTAGAATCGATGGTCAAGATCTTCGACTGAA
GCTGCAGAAGAAGAATGCATCAGCTCCTGCTGAAAGTGGGAGAAGAAGTGGCGTGCGAGATTTGCGAGAGAAACTATCTGGAACAATGAATCCACAACCA
GTGAATGCTGATCCTCCCAAGTTGACTAGGAGAAGCGCTGCTGTTGAAGCTCTTCAACCCGAGGTTAATAAAGTTGCCACTGTAGGAGCCAAAAAGAAGG
CCCAGCAGAAGGCAAATGTATCATCAGTGGACAGCTTTTTGCAATCATTGGGTCTTGAAAAATACCTGATCACTTTCCAGGCTGAGGAAGTTGATATGAC
TGCGCTCCTACACATGACTGATGATGATCTCAAGGCTATGGGAGTTCCAATGGGTCCAAGAAAGAAGATACTGCTGGCATTGGAATCAAGGGGCTAA
AA sequence
>Lus10022780 pacid=23160027 polypeptide=Lus10022780 locus=Lus10022780.g ID=Lus10022780.BGIv1.0 annot-version=v1.0
MYADRVEVSGKMSVKERLNGSSLGDSSRRKQVTGKRQRQDDKWEHDLYNNEPRTSNRRIDGQDLRLKLQKKNASAPAESGRRSGVRDLREKLSGTMNPQP
VNADPPKLTRRSAAVEALQPEVNKVATVGAKKKAQQKANVSSVDSFLQSLGLEKYLITFQAEEVDMTALLHMTDDDLKAMGVPMGPRKKILLALESRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07170 Sterile alpha motif (SAM) doma... Lus10022780 0 1
AT3G48710 DEK domain-containing chromati... Lus10025759 5.7 0.8903
AT3G60670 PLATZ transcription factor fam... Lus10009283 6.8 0.9147
AT3G48710 DEK domain-containing chromati... Lus10022439 9.4 0.8853
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Lus10023236 10.8 0.8106
AT3G63480 ATP binding microtubule motor ... Lus10029983 11.9 0.8331
AT5G02570 Histone superfamily protein (.... Lus10040850 14.6 0.8953
AT5G03500 Mediator complex, subunit Med7... Lus10016217 20.5 0.7943
AT1G04150 C2 calcium/lipid-binding plant... Lus10011271 22.0 0.8851
AT5G13020 AtEML3, ACK1 EMSY-like 3, Emsy N Terminus (... Lus10031799 28.6 0.8196
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10015637 38.7 0.8313

Lus10022780 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.