Lus10022781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48170 156 / 6e-50 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022783 242 / 5e-84 AT1G48170 177 / 3e-58 unknown protein
Lus10011844 216 / 8e-74 AT1G48170 176 / 1e-57 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G099700 164 / 8e-53 AT1G48170 191 / 4e-63 unknown protein
PFAM info
Representative CDS sequence
>Lus10022781 pacid=23159914 polypeptide=Lus10022781 locus=Lus10022781.g ID=Lus10022781.BGIv1.0 annot-version=v1.0
ATGGAAAATGCTGGCGGGGAACTGAGAATCCACTGTTTCACAGAAGTAGTCGATGAAGTCACTCTCCATTTCCAGATCATACGACTCCCCAAGCAGATAT
ACGCATGGGTCGGTTGCAATTCCTCCAAGTTGGGTCACCTTTATGCAGCTGCCAACACTCGCCCTTCGCAGAGTGGCAGTGTAAGTGTGAGCTGTGTGCT
CGGAGGAGCTTCTGATAACACCGGGTCTGGTATTGCCCGCCGTATAGTGTTAAAGAGTGGCCTTAACGTCATGCTTGCTTGTAATATCCCCAAGAACAGT
CCTATGATTGAGGCAAATGCCGAGAGGAAAATGATGGAGAAGCTCGTTCAACTGGGATATACGCAGCCAAACCTAAAACGATTGTCTCTTTGCGATAACT
GA
AA sequence
>Lus10022781 pacid=23159914 polypeptide=Lus10022781 locus=Lus10022781.g ID=Lus10022781.BGIv1.0 annot-version=v1.0
MENAGGELRIHCFTEVVDEVTLHFQIIRLPKQIYAWVGCNSSKLGHLYAAANTRPSQSGSVSVSCVLGGASDNTGSGIARRIVLKSGLNVMLACNIPKNS
PMIEANAERKMMEKLVQLGYTQPNLKRLSLCDN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48170 unknown protein Lus10022781 0 1
AT1G48170 unknown protein Lus10022783 1.0 0.9343
AT5G62430 DOF CDF1, AtDof5,5 cycling DOF factor 1 (.1) Lus10020315 3.5 0.7763
Lus10008493 4.5 0.7342
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10008900 7.7 0.7545
AT1G14990 unknown protein Lus10035021 8.5 0.7384
AT4G16330 2-oxoglutarate (2OG) and Fe(II... Lus10035702 9.5 0.6906
AT5G62430 DOF CDF1, AtDof5,5 cycling DOF factor 1 (.1) Lus10020314 11.5 0.7054
AT1G53530 Peptidase S24/S26A/S26B/S26C f... Lus10015272 12.4 0.7485
AT2G17020 F-box/RNI-like superfamily pro... Lus10012518 13.5 0.7725
AT1G31360 MED34, ATRECQ2,... ARABIDOPSIS THALIANA RECQ 2, ... Lus10034749 14.1 0.7066

Lus10022781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.