Lus10022782 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25050 246 / 5e-81 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT4G13090 245 / 1e-80 XTH2 xyloglucan endotransglucosylase/hydrolase 2 (.1)
AT4G13080 236 / 5e-77 XTH1 xyloglucan endotransglucosylase/hydrolase 1 (.1)
AT5G13870 207 / 5e-66 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT4G37800 202 / 4e-64 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT2G06850 197 / 4e-62 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT5G65730 196 / 2e-61 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT1G11545 194 / 1e-60 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
AT2G14620 193 / 4e-60 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1)
AT4G03210 188 / 3e-58 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022784 573 / 0 AT3G25050 239 / 1e-78 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Lus10011845 544 / 0 AT3G25050 241 / 3e-79 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Lus10025919 287 / 3e-97 AT4G13090 318 / 4e-109 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Lus10038182 287 / 5e-97 AT4G13090 319 / 2e-109 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Lus10032879 213 / 1e-67 AT4G13090 248 / 2e-81 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Lus10039643 205 / 8e-65 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10011597 204 / 1e-64 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10003022 198 / 4e-62 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10035654 196 / 2e-61 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G244200 254 / 5e-84 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Potri.003G159700 206 / 4e-65 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.001G071000 205 / 6e-65 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 202 / 8e-64 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.007G008500 201 / 1e-63 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.009G083800 192 / 6e-60 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Potri.006G170001 187 / 3e-58 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 187 / 3e-58 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G170100 187 / 3e-58 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G084300 186 / 1e-57 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10022782 pacid=23160035 polypeptide=Lus10022782 locus=Lus10022782.g ID=Lus10022782.BGIv1.0 annot-version=v1.0
ATGAAGAAATCAACTGTTGTTCTTCTGATGATCATCCTTGTGGTACCGAATATTGCCGATCATGGCCAAACTCGATTCGAAGACAATTTCATAGTCACGT
GGGGATTCGATCACTTCCAGCTGCTTGACAATGGCACTGAAGTTCAGCTCACCCTGGATGGTGTCAAAGGAGGTGCTGGATTCGAGTCCAAACGGAGTTA
CGGGTCGGGAGTCTTCCACGTGAAGATGAAGGTTCCTAAGAGGAATTCTTCTGGAGTTGTCACTGCTTTCTACCTAACTTCCGATGATCCGGGACAAGAC
GAGCTAGATTTTGAGATGCTCGGCTCGCCGGACGACGGTAGTCCGTTCAATTTACAGACGAACATGTTTGTAAACGGCGTCGGAGGCAAAGAGCAACACA
TTCTTCTCTGGTTCGACCCAACCGCCGATTTCCACGACTACACTATCCTCTGGAACCAACATCAAATCATATTTTCCGCCGACGGGGTTCCGGTGAGAGT
GATAAGGAAATCCGACGTCACGGCCTACCCGTCGACGAAGGCGATGACGGTGGTTGCCAGCCTGTGGAATGGAGAGTGGTGGGGGAAAGTCAACTGGAGC
TACGCTCCCTTCGTGGCGAACTTCAAGGATTTCAGCCTCGCCGGATGTCCCGCCGTCGAGGGTTCCGATCTGGCACCGTGCTTCTCTTCGTCGGAGGATT
ACTGGTGGAATTCGGAGGAGTATTGGACGTTGGATCCGGTGCAAGAGAAGGCGTACGAGGATGTCACTTTGCAGTATATGGGATTTAACTATTGCGACGT
TATTAAGACTCCTCTGCCGCCGGAATGTGACCGGTGA
AA sequence
>Lus10022782 pacid=23160035 polypeptide=Lus10022782 locus=Lus10022782.g ID=Lus10022782.BGIv1.0 annot-version=v1.0
MKKSTVVLLMIILVVPNIADHGQTRFEDNFIVTWGFDHFQLLDNGTEVQLTLDGVKGGAGFESKRSYGSGVFHVKMKVPKRNSSGVVTAFYLTSDDPGQD
ELDFEMLGSPDDGSPFNLQTNMFVNGVGGKEQHILLWFDPTADFHDYTILWNQHQIIFSADGVPVRVIRKSDVTAYPSTKAMTVVASLWNGEWWGKVNWS
YAPFVANFKDFSLAGCPAVEGSDLAPCFSSSEDYWWNSEEYWTLDPVQEKAYEDVTLQYMGFNYCDVIKTPLPPECDR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10022782 0 1
Lus10000351 2.2 1.0000
Lus10002886 3.2 1.0000
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021543 3.9 1.0000
Lus10014748 4.5 1.0000
AT3G26880 Plant self-incompatibility pro... Lus10022631 5.0 1.0000
Lus10023108 6.0 1.0000
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10023249 6.5 1.0000
Lus10024321 6.9 1.0000
AT2G02850 ARPN plantacyanin (.1) Lus10028396 7.3 1.0000
Lus10022162 7.7 0.7497

Lus10022782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.