Lus10022784 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25050 240 / 1e-78 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT4G13090 237 / 1e-77 XTH2 xyloglucan endotransglucosylase/hydrolase 2 (.1)
AT4G13080 228 / 3e-74 XTH1 xyloglucan endotransglucosylase/hydrolase 1 (.1)
AT5G13870 201 / 2e-63 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT4G37800 195 / 3e-61 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT2G06850 191 / 2e-59 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT5G65730 189 / 1e-58 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT1G11545 187 / 6e-58 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
AT2G14620 186 / 2e-57 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1)
AT4G03210 181 / 1e-55 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022782 573 / 0 AT3G25050 246 / 5e-81 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Lus10011845 538 / 0 AT3G25050 241 / 3e-79 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Lus10025919 280 / 3e-94 AT4G13090 318 / 4e-109 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Lus10038182 280 / 3e-94 AT4G13090 319 / 2e-109 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Lus10032879 205 / 9e-65 AT4G13090 248 / 2e-81 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Lus10039643 197 / 5e-62 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10011597 197 / 6e-62 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10003022 191 / 2e-59 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10035654 190 / 5e-59 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G244200 246 / 4e-81 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Potri.003G159700 199 / 2e-62 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.001G071000 198 / 3e-62 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 196 / 3e-61 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.007G008500 194 / 1e-60 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.009G083800 186 / 1e-57 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Potri.006G170001 181 / 1e-55 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 181 / 1e-55 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G170100 181 / 1e-55 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G084300 179 / 8e-55 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10022784 pacid=23159950 polypeptide=Lus10022784 locus=Lus10022784.g ID=Lus10022784.BGIv1.0 annot-version=v1.0
ATGAAGAAATCAACTGTTGTTCTTCTGATGATCATCCTTGTGGTACCGAATATTGCCGATCATGGCCAAACTCGATTCGAAGACAATTTCATAGTCACGT
GGGGATTCGATCACTTCCAGCTGCTTGACAATGGCACTGAAGTTCAGCTCACCCTGGATGGTGTCAAAGGAGGTGCTGGATTCGAGTCCAAACGGAGTTA
CGGGTCGGGAGTCTTCCACGTGAAGATGAAGGTTCCTAAGAGGAATTCTTCTGGAGTTGTCACTGCTTTCTACCTAACTTCCGATGATCCGGGACAAGAC
GAGCTAGATTTTGAGATGCTCGGCTCGCCGGACGACGGTAGTCCGTTCAATTTACAGACGAACATGTTTGTAAACGGCGTCGGAGGCAAAGAGCAACACA
TTCTTCTCTGGTTCGACCCAACCGCCGATTTCCACGACTACACATACCTCCGGAACCAACATCAAATCATATTTTCCGCCGACGGGGTTCCGGTGAGAGT
GATAAGGAAATCCGACGTCACGGCCTACCCGTCGACGAAGGCGATGACGGTGGTTGCCAGCCTGTGGAATGGAGAGTGGTGGGGGAAAGTCAACTGGAGC
TACGCTCCCTTCGTGGCGAACTTCAAGGATTTCAGCCTCGCCGGATGTCCCGCCGTCGAGGGTTCCGATCTGGCACCGTGCTTCTCTTCGTCGGAGGATT
ACTGGTGGAATTCGGAGGAGTATTGGACGTTGGATCCGGTGCAAGAGAAGGCGTACGAGGATGTCACTTTGCAGTATATGGGATTTAACTATTGCGACGT
TATTAAGACTCCTCTGCCGCCGGAATGTGACCGGTGA
AA sequence
>Lus10022784 pacid=23159950 polypeptide=Lus10022784 locus=Lus10022784.g ID=Lus10022784.BGIv1.0 annot-version=v1.0
MKKSTVVLLMIILVVPNIADHGQTRFEDNFIVTWGFDHFQLLDNGTEVQLTLDGVKGGAGFESKRSYGSGVFHVKMKVPKRNSSGVVTAFYLTSDDPGQD
ELDFEMLGSPDDGSPFNLQTNMFVNGVGGKEQHILLWFDPTADFHDYTYLRNQHQIIFSADGVPVRVIRKSDVTAYPSTKAMTVVASLWNGEWWGKVNWS
YAPFVANFKDFSLAGCPAVEGSDLAPCFSSSEDYWWNSEEYWTLDPVQEKAYEDVTLQYMGFNYCDVIKTPLPPECDR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10022784 0 1

Lus10022784 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.