Lus10022793 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48760 357 / 3e-127 Ribosomal protein L13 family protein (.1.2)
AT4G13170 355 / 3e-126 Ribosomal protein L13 family protein (.1)
AT3G24830 350 / 1e-124 Ribosomal protein L13 family protein (.1)
AT3G07110 350 / 2e-124 Ribosomal protein L13 family protein (.1.2)
AT1G78630 54 / 9e-09 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011857 378 / 2e-135 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10016679 357 / 5e-127 AT5G48760 386 / 9e-139 Ribosomal protein L13 family protein (.1.2)
Lus10007137 352 / 2e-125 AT5G48760 384 / 6e-138 Ribosomal protein L13 family protein (.1.2)
Lus10043151 350 / 3e-124 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10032599 350 / 3e-124 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10005553 46 / 6e-06 AT1G78630 332 / 8e-116 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G314500 347 / 2e-123 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Potri.002G242600 346 / 5e-123 AT4G13170 357 / 4e-127 Ribosomal protein L13 family protein (.1)
Potri.017G054600 342 / 4e-121 AT5G48760 351 / 5e-125 Ribosomal protein L13 family protein (.1.2)
Potri.001G384600 49 / 7e-07 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.011G106100 48 / 1e-06 AT1G78630 342 / 3e-120 embryo defective 1473, Ribosomal protein L13 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Lus10022793 pacid=23159902 polypeptide=Lus10022793 locus=Lus10022793.g ID=Lus10022793.BGIv1.0 annot-version=v1.0
ATGGTGTCCGGATCGGGGATCTGCGCAAAGAGGGTGGTGGTTGACGCTAGGCACCACATGCTCGGACGGCTGGCGTCCATCACGGCGAAGGAGCTGCTCA
ATGGCCAGAAAGTGGTGGTCGTGAGGTGCGAGGAGATCTGCATGTCCGGCGGACTGGTGCGGCAGAAGATGAAATACATGAGGTTCCTCCGCAAGCGAAT
GAACACCAAGCCTTCTCATGGTCCCATCCACTTCCGCGCTCCTTCCAAAATCTTCTGGCGAACTGTTCGCGGAATGATTCCTCACAAGACAAAGAGAGGA
GAAGCTGCACTTGCAAGGTTGAAGGTTTACGAAGGCGTCCCACCTCCATATGACAAGGTCAAGAGGATGGTTGTCCCTGATGCTCTCAAGGTTTTGAGGC
TCCAGAAGGGACACAAACACTGCTTGCTGGGTCAGCTTTCAGCACAGGTCGGATGGAACTACTATGACACCATCAAGGAGCTGGAGGAGAGGAGAAAGGA
GAAGAGTAAGGTGGTGTACGAGAGGAAGAAGCAGCTGAACAAGCTGAGGGCAAAGGCTGAGAAGGTAGCAGAGGAGAAGCTTGGTTCCCAATTAGATATC
CTCGCACCAGTTAAGTACTGA
AA sequence
>Lus10022793 pacid=23159902 polypeptide=Lus10022793 locus=Lus10022793.g ID=Lus10022793.BGIv1.0 annot-version=v1.0
MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRG
EAALARLKVYEGVPPPYDKVKRMVVPDALKVLRLQKGHKHCLLGQLSAQVGWNYYDTIKELEERRKEKSKVVYERKKQLNKLRAKAEKVAEEKLGSQLDI
LAPVKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48760 Ribosomal protein L13 family p... Lus10022793 0 1
AT4G15000 Ribosomal L27e protein family ... Lus10010461 1.4 0.9159
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10013381 1.7 0.9252
AT5G18380 Ribosomal protein S5 domain 2-... Lus10012599 4.2 0.8814
AT2G31610 Ribosomal protein S3 family pr... Lus10033442 4.5 0.8832
AT3G12150 unknown protein Lus10035501 5.7 0.8787
AT3G13580 Ribosomal protein L30/L7 famil... Lus10016970 6.3 0.8917
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10029879 6.7 0.8761
AT5G48760 Ribosomal protein L13 family p... Lus10011857 6.7 0.8954
AT5G39850 Ribosomal protein S4 (.1) Lus10042193 6.9 0.8684
AT3G25230 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rota... Lus10002338 9.5 0.8792

Lus10022793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.