Lus10022802 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24770 37 / 0.0005 CLE41 CLAVATA3/ESR-RELATED 41 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011868 78 / 1e-19 AT3G24770 39 / 1e-04 CLAVATA3/ESR-RELATED 41 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G241300 40 / 5e-05 AT3G24770 52 / 1e-09 CLAVATA3/ESR-RELATED 41 (.1)
Potri.012G019400 37 / 0.0007 AT3G24770 54 / 2e-10 CLAVATA3/ESR-RELATED 41 (.1)
PFAM info
Representative CDS sequence
>Lus10022802 pacid=23160045 polypeptide=Lus10022802 locus=Lus10022802.g ID=Lus10022802.BGIv1.0 annot-version=v1.0
ATGGATATTGAACCCTTGTGGGAACTTGGGGGGTGGTTTCTTCTTTCTTCTTCTCCGACTCGGTACTCCGATTGCATGGCTACAATCTCGAAACCTCCTC
ATTGCCGCGGTCGAAACCTTGTCTCCCTCTCCTTCCTGCTCTCCCTCTTCCTCCTCCTCCTCCTCTTCACACCTTCAACTCCAACAACACAACCTTCTCC
GATTTCAGAATCCTCCTCCACCACCACCACAACAACAACCTTACACCATAAACAAACGAAAGAAAGGGCGAGGAGATCGGACTACTTTGGAGCCGATGAG
CACGAGGTTCCTAGCGGTCCGAACCCCATCTCCAACTAG
AA sequence
>Lus10022802 pacid=23160045 polypeptide=Lus10022802 locus=Lus10022802.g ID=Lus10022802.BGIv1.0 annot-version=v1.0
MDIEPLWELGGWFLLSSSPTRYSDCMATISKPPHCRGRNLVSLSFLLSLFLLLLLFTPSTPTTQPSPISESSSTTTTTTTLHHKQTKERARRSDYFGADE
HEVPSGPNPISN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022802 0 1
AT3G24770 CLE41 CLAVATA3/ESR-RELATED 41 (.1) Lus10011868 2.2 0.9340
AT4G36710 GRAS AtHAM4 Arabidopsis thaliana HAIRY MER... Lus10041721 6.5 0.8879
Lus10025868 11.6 0.9075
AT1G60783 unknown protein Lus10026693 12.1 0.8870
AT2G36650 unknown protein Lus10014389 13.7 0.8980
AT5G63710 Leucine-rich repeat protein ki... Lus10025703 14.1 0.8931
Lus10028522 16.1 0.8751
AT4G05400 copper ion binding (.1.2) Lus10035454 16.2 0.8150
Lus10022166 16.4 0.8121
AT2G32830 PHT1;5, PHT5 PHOSPHATE TRANSPORTER 5, phosp... Lus10022547 17.9 0.8520

Lus10022802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.