Lus10022824 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04347 67 / 8e-15 Plant self-incompatibility protein S1 family (.1)
AT4G16295 64 / 2e-13 SPH1 S-protein homologue 1 (.1)
AT2G06090 63 / 3e-13 Plant self-incompatibility protein S1 family (.1)
AT4G29035 62 / 1e-12 Plant self-incompatibility protein S1 family (.1)
AT3G26880 56 / 9e-11 Plant self-incompatibility protein S1 family (.1)
AT5G04350 56 / 1e-10 Plant self-incompatibility protein S1 family (.1)
AT1G26797 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT3G26870 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
AT5G06020 52 / 4e-09 Plant self-incompatibility protein S1 family (.1)
AT5G12060 51 / 1e-08 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011892 252 / 2e-87 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10022826 218 / 5e-74 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1)
Lus10022825 132 / 3e-40 AT4G29035 43 / 7e-06 Plant self-incompatibility protein S1 family (.1)
Lus10011895 105 / 1e-29 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10011897 98 / 7e-27 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10029375 91 / 8e-24 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10022830 87 / 2e-22 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1)
Lus10029390 86 / 6e-22 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10042506 85 / 2e-21 AT4G16295 112 / 5e-32 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 109 / 5e-31 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 72 / 2e-16 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199700 69 / 1e-15 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.004G199801 69 / 2e-15 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.010G008300 64 / 2e-13 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 51 / 2e-08 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 48 / 9e-08 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 49 / 1e-07 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 48 / 2e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 42 / 2e-05 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10022824 pacid=23159964 polypeptide=Lus10022824 locus=Lus10022824.g ID=Lus10022824.BGIv1.0 annot-version=v1.0
ATGTCAACAACCTCCGTTGTCGTCCTTGCAATATTCGCACTTTCAGCCGCCGTCGCTGTAACTCCCTCCGCAGCCGGTTACACCCCGTTTCCCGTGCACC
ACGTCCACGTCACCAGCCAACTGACCCGCGGGAAGGTGCTGCTGGTACATTGTCAGTCTAAGGACGACGACCTCGGGGTCCACAACCTGACCACCGGTGG
CGAATTAAAGTGGCAGTTCAGGCTGAATGTCCTCGGCCACACGCTGTTCTGGTGCTACCTGGCCCCCGACCATTCGCATCACATCGCGTACGACGCGTTC
AAGGAAGAGGACGCCGACTACCAGGAGTACTATTTTCATACGTATTGGTTTGCGAAAGACGACGAGGTTTATTTGAGACGGGTGCGGGAGAAGGTCGATC
ATGTTACTTCGGGTGGGAAAATGGGAGGGGTTTGTTGA
AA sequence
>Lus10022824 pacid=23159964 polypeptide=Lus10022824 locus=Lus10022824.g ID=Lus10022824.BGIv1.0 annot-version=v1.0
MSTTSVVVLAIFALSAAVAVTPSAAGYTPFPVHHVHVTSQLTRGKVLLVHCQSKDDDLGVHNLTTGGELKWQFRLNVLGHTLFWCYLAPDHSHHIAYDAF
KEEDADYQEYYFHTYWFAKDDEVYLRRVREKVDHVTSGGKMGGVC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04347 Plant self-incompatibility pro... Lus10022824 0 1
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10024389 4.2 0.7542
Lus10007416 14.6 0.8537
AT4G35900 bZIP ATBZIP14, FD-1,... Basic-leucine zipper (bZIP) tr... Lus10028419 35.8 0.7547
AT4G36920 AP2_ERF FL1, FLO2, AP2 FLORAL MUTANT 2, FLOWER 1, APE... Lus10019331 57.6 0.6499
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10006726 121.8 0.6706
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10041558 122.2 0.6706
AT1G18790 AtRKD1, RKD1 RWP-RK domain containing 1, RW... Lus10034456 122.6 0.6706
AT1G20480 AMP-dependent synthetase and l... Lus10011621 123.0 0.6706
AT2G25737 Sulfite exporter TauE/SafE fam... Lus10022134 123.5 0.6706
AT5G12060 Plant self-incompatibility pro... Lus10022829 123.9 0.6706

Lus10022824 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.