Lus10022825 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29035 40 / 0.0001 Plant self-incompatibility protein S1 family (.1)
AT4G10895 39 / 0.0002 Plant self-incompatibility protein S1 family (.1)
AT4G16295 38 / 0.0006 SPH1 S-protein homologue 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022826 155 / 1e-49 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1)
Lus10011892 128 / 7e-39 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10022824 106 / 2e-30 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1)
Lus10029383 59 / 9e-12 AT5G04350 63 / 6e-13 Plant self-incompatibility protein S1 family (.1)
Lus10029375 58 / 2e-11 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10016171 57 / 5e-11 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10011895 55 / 4e-10 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10014630 53 / 7e-10 AT5G38435 57 / 1e-11 S-protein homologue 8 (.1)
Lus10022631 51 / 7e-09 AT3G26880 65 / 2e-14 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 59 / 1e-11 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 40 / 9e-05 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10022825 pacid=23159939 polypeptide=Lus10022825 locus=Lus10022825.g ID=Lus10022825.BGIv1.0 annot-version=v1.0
ATGACAACGCCAACCTCCGTCGTCGTCCTTGCGATACTGGCGCTTTCAGCCGCTGTCGCTATAACTCCCTCCACCGCCGGTCTCACCCCGGTCCACCACG
TCCACATCACCAGCGACCTTACCGGCGGGAAGGCGCTGGCTGTGCGGCGGGAAGGTGCTGCTGGTACATTCATCATAGCGGACACGCTGTTCTGGTGCTA
CCTGGCTCCCGATGATTCGCACCACATCTCGTTCGAGGCGTGGAACAAAAAGGAGGCCAATTATAGGGAGAACCATCTTCATACGTATTGGCGTGCGAAA
GACGACGGGGTTTATTTGCGACGGGTGAAGCAGAACGTCGATGAGCATTTGGCCGGGTGGGAAGATGGCAGGGGCATGATGAACCGGACTCGGGTTATCT
GA
AA sequence
>Lus10022825 pacid=23159939 polypeptide=Lus10022825 locus=Lus10022825.g ID=Lus10022825.BGIv1.0 annot-version=v1.0
MTTPTSVVVLAILALSAAVAITPSTAGLTPVHHVHITSDLTGGKALAVRREGAAGTFIIADTLFWCYLAPDDSHHISFEAWNKKEANYRENHLHTYWRAK
DDGVYLRRVKQNVDEHLAGWEDGRGMMNRTRVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29035 Plant self-incompatibility pro... Lus10022825 0 1
Lus10038154 1.0 0.9806
AT4G18770 MYB ATMYB98 myb domain protein 98 (.1) Lus10042111 2.4 0.9509
AT1G73110 P-loop containing nucleoside t... Lus10024092 3.0 0.9679
AT2G45650 MADS AGL6 AGAMOUS-like 6 (.1) Lus10015017 3.2 0.9695
AT2G04570 GDSL-like Lipase/Acylhydrolase... Lus10015162 4.9 0.9421
AT5G10520 RBK1 ROP binding protein kinases 1 ... Lus10002659 5.7 0.9552
Lus10033284 5.9 0.9485
AT5G41020 MYB myb family transcription facto... Lus10022932 5.9 0.9528
AT3G05610 Plant invertase/pectin methyle... Lus10020909 6.3 0.9150
AT4G36250 ALDH3F1 aldehyde dehydrogenase 3F1 (.1... Lus10027372 7.2 0.9380

Lus10022825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.