Lus10022828 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60720 42 / 5e-05 PDLP8 plasmodesmata-located protein 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011894 249 / 9e-87 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Lus10020927 60 / 4e-12 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10033450 60 / 4e-12 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10028019 59 / 8e-12 AT1G70530 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10033389 59 / 9e-12 AT1G19090 44 / 2e-05 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10012369 57 / 4e-11 AT4G11470 42 / 6e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1)
Lus10015472 57 / 5e-11 AT5G48540 42 / 4e-05 receptor-like protein kinase-related family protein (.1)
Lus10028018 55 / 6e-10 ND 39 / 5e-04
Lus10003752 49 / 7e-08 AT1G70690 41 / 9e-05 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 57 / 6e-11 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.010G108100 42 / 4e-05 AT2G01660 265 / 2e-88 plasmodesmata-located protein 6 (.1.2)
Potri.011G027900 40 / 0.0002 AT4G23180 542 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G027800 40 / 0.0002 AT4G23180 516 / 9e-176 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10022828 pacid=23159922 polypeptide=Lus10022828 locus=Lus10022828.g ID=Lus10022828.BGIv1.0 annot-version=v1.0
ATGAAAGGAATAAATACAATCCCGTCGCTATTGCTCCTTTCAGTCGTCGTCTTTTCTCTCACTTTGACCATCGCGAATGCTGAGCTGGACAAAGGGTTCA
TTTCCCGAAACTGCAGCAACGAGAGGTACTCGAAGAACGACGGAGTCAAGCATTCAATCTCCGTGGTGCTCACGCAGCTGGTGTCGGAGGCCGTCGACAG
GATAACCGTCCACAACAAGGATTACCGTGCGAAATACCCTTCTAATAATTCCCCTCCATTGGTGTACGGACATGCTTACTGTTGGCGGACTTGGGGGATC
CAGTCGACGTGCAGGAGCTGTCTGAAGCAAGCAAAGAGGATGCTCGTTCGCGGGTGCCCCCACAGAGCCGGAGCTTCCATCGAATTGGAGATGTGCTCTT
TGCGTTACGAGAAGTTCGAGATCTAG
AA sequence
>Lus10022828 pacid=23159922 polypeptide=Lus10022828 locus=Lus10022828.g ID=Lus10022828.BGIv1.0 annot-version=v1.0
MKGINTIPSLLLLSVVVFSLTLTIANAELDKGFISRNCSNERYSKNDGVKHSISVVLTQLVSEAVDRITVHNKDYRAKYPSNNSPPLVYGHAYCWRTWGI
QSTCRSCLKQAKRMLVRGCPHRAGASIELEMCSLRYEKFEI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G01660 PDLP6 plasmodesmata-located protein ... Lus10022828 0 1

Lus10022828 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.