Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12060 46 / 2e-07 Plant self-incompatibility protein S1 family (.1) AT4G29035 43 / 3e-06 Plant self-incompatibility protein S1 family (.1) AT4G16295 43 / 4e-06 SPH1 S-protein homologue 1 (.1) AT5G12070 37 / 0.0003 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022830 [exp] 163 / 3e-53 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1) Lus10011896 [exp] 128 / 7e-40 AT2G06090 62 / 5e-13 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 118 / 1e-35 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10000683 [exp] 79 / 5e-20 AT4G16295 57 / 5e-11 S-protein homologue 1 (.1) Lus10000682 [exp] 79 / 1e-19 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1) Lus10000558 [exp] 76 / 3e-19 AT4G16295 55 / 1e-10 S-protein homologue 1 (.1) Lus10021634 [exp] 73 / 1e-17 AT4G29035 58 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10022824 [exp] 65 / 1e-14 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1) Lus10011892 [exp] 64 / 3e-14 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G252500 [exp] 47 / 9e-08 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.016G066900 [exp] 44 / 1e-06 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 37 / 0.0004 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10022829 pacid=23160019 polypeptide=Lus10022829 locus=Lus10022829.g ID=Lus10022829.BGIv1.0 annot-version=v1.0 ATGGGGATCCACTGGGTCGGCCCACATGGGGAGTATGAGTGGAGGTTCAAGCCCACAATTACCGGCGACACTTTGTTCTGGTGCCACGTGTCGAAACATG GCAAAGAAATTGTCTACGACGCTTACTGGGAGGACGACAATGACTACGAGAGGATACACCTGGACCACATTCGTTGGGTGGCGAAAGACGACAGCATTTA TCTCCGACAGTTCTGGAAACCTAACGGCGGTGTCGATGTCTTCTGGAAACTATGGCCGCAAGTGACGATGTTTTGA
AA sequence Show only first row Show all	>Lus10022829 pacid=23160019 polypeptide=Lus10022829 locus=Lus10022829.g ID=Lus10022829.BGIv1.0 annot-version=v1.0 MGIHWVGPHGEYEWRFKPTITGDTLFWCHVSKHGKEIVYDAYWEDDNDYERIHLDHIRWVAKDDSIYLRQFWKPNGGVDVFWKLWPQVTMF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12060			Plant self-incompatibility pro...		Lus10022829 [exp]	0	1
					Lus10000363 [exp]	2.6	1.0000
AT3G10340		PAL4	phenylalanine ammonia-lyase 4 ...		Lus10001405 [exp]	4.5	1.0000
					Lus10003285 [exp]	4.6	1.0000
					Lus10004996 [exp]	6.3	1.0000
					Lus10025781 [exp]	6.7	1.0000
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10027745 [exp]	7.3	1.0000
AT1G61330			FBD, F-box and Leucine Rich Re...		Lus10006726 [exp]	8.4	1.0000
					Lus10000977 [exp]	9.0	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10002747 [exp]	9.5	1.0000
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10003300 [exp]	9.9	1.0000

Compare expression of checked genes

Lus10022829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.