Lus10022830 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16295 65 / 7e-14 SPH1 S-protein homologue 1 (.1)
AT2G06090 64 / 9e-14 Plant self-incompatibility protein S1 family (.1)
AT4G29035 60 / 7e-12 Plant self-incompatibility protein S1 family (.1)
AT5G12060 57 / 4e-11 Plant self-incompatibility protein S1 family (.1)
AT1G04645 57 / 7e-11 Plant self-incompatibility protein S1 family (.1)
AT5G27238 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
AT5G04350 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT3G17080 51 / 9e-09 Plant self-incompatibility protein S1 family (.1)
AT3G10460 49 / 3e-08 Plant self-incompatibility protein S1 family (.1)
AT5G12070 49 / 6e-08 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011897 166 / 1e-53 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10011896 165 / 2e-53 AT2G06090 62 / 5e-13 Plant self-incompatibility protein S1 family (.1)
Lus10022829 159 / 9e-52 AT5G12060 46 / 2e-07 Plant self-incompatibility protein S1 family (.1)
Lus10000682 107 / 3e-30 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1)
Lus10000683 107 / 3e-30 AT4G16295 57 / 5e-11 S-protein homologue 1 (.1)
Lus10021634 102 / 2e-28 AT4G29035 58 / 4e-11 Plant self-incompatibility protein S1 family (.1)
Lus10000558 94 / 1e-25 AT4G16295 55 / 1e-10 S-protein homologue 1 (.1)
Lus10021633 95 / 2e-25 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1)
Lus10016350 89 / 3e-23 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G252500 81 / 6e-20 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.016G066900 74 / 4e-17 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 66 / 4e-14 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.003G201300 59 / 1e-11 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 52 / 5e-09 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 49 / 7e-08 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 49 / 9e-08 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.003G175200 47 / 5e-07 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 44 / 4e-06 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 44 / 4e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10022830 pacid=23159984 polypeptide=Lus10022830 locus=Lus10022830.g ID=Lus10022830.BGIv1.0 annot-version=v1.0
ATGAAGTCGTCGGCGTCATCAACCGTCGCCGCCATACTTGTGGCCGCCACAGTGTTGTCGTTTTCCATCCTAGCCTCCGCCAAAGACTCGTGGTGGAATT
ACACGCATGTGCACATTATCAACGGGTTCGAGGAACACCACTACCCGTTGATGGTGCACTGCAAGTCTAAGGACGACGACATGGGGATCCACTGGGTCGG
CCCACATGGGGAGTACGAGTGGAGGTTCAAGCCCAAAATTACAGGCAACACTTTGTTCTGGTGCCAAGTGGAGAAACATGGCAAGGAAATTGTCTTCGAC
GCTTACTGGGAGGACGACAAGACCTACAACAGGAAGTACATGGACCACGTACGTTGGGTAGCAAAAGACGACGGCATTTATTTGCGACAGTTCTGGAAAC
CTAACGGCGGTGTCGATGTCTTCTGGAAAGCATGGCCGCAGTGA
AA sequence
>Lus10022830 pacid=23159984 polypeptide=Lus10022830 locus=Lus10022830.g ID=Lus10022830.BGIv1.0 annot-version=v1.0
MKSSASSTVAAILVAATVLSFSILASAKDSWWNYTHVHIINGFEEHHYPLMVHCKSKDDDMGIHWVGPHGEYEWRFKPKITGNTLFWCQVEKHGKEIVFD
AYWEDDKTYNRKYMDHVRWVAKDDGIYLRQFWKPNGGVDVFWKAWPQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G06090 Plant self-incompatibility pro... Lus10022830 0 1

Lus10022830 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.