Lus10022831 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G06090 64 / 2e-13 Plant self-incompatibility protein S1 family (.1)
AT4G16295 62 / 7e-13 SPH1 S-protein homologue 1 (.1)
AT4G29035 62 / 1e-12 Plant self-incompatibility protein S1 family (.1)
AT3G26880 56 / 9e-11 Plant self-incompatibility protein S1 family (.1)
AT3G27680 53 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT3G10460 51 / 9e-09 Plant self-incompatibility protein S1 family (.1)
AT5G27238 51 / 1e-08 Plant self-incompatibility protein S1 family (.1)
AT5G04350 50 / 3e-08 Plant self-incompatibility protein S1 family (.1)
AT2G24870 49 / 6e-08 Plant self-incompatibility protein S1 family (.1)
AT3G16970 48 / 2e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022826 82 / 3e-20 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1)
Lus10022835 79 / 2e-19 AT3G26880 47 / 2e-07 Plant self-incompatibility protein S1 family (.1)
Lus10011892 78 / 7e-19 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10038163 77 / 1e-18 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1)
Lus10025935 76 / 2e-18 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10025937 78 / 7e-18 AT3G26880 68 / 4e-14 Plant self-incompatibility protein S1 family (.1)
Lus10022824 75 / 8e-18 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1)
Lus10038164 73 / 4e-17 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10011895 72 / 2e-16 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 86 / 6e-22 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 67 / 7e-15 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.010G008300 59 / 7e-12 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 56 / 2e-10 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.004G199801 54 / 2e-09 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.018G148366 47 / 1e-07 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.018G148700 47 / 4e-07 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 47 / 6e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 45 / 2e-06 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 44 / 4e-06 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10022831 pacid=23160052 polypeptide=Lus10022831 locus=Lus10022831.g ID=Lus10022831.BGIv1.0 annot-version=v1.0
ATGAATACACTGGAAAAACTCAAAGTTGTGACACTGGTTTTGTGTACCACGACCATCCTAGTATATCCTGGTCCCTCGACGCATCAATACAGTGTCCATA
TTACCAACAATTTAACCGGCTCGAGAGACCTCGCAGTGCACTGCCAATCGAAAGACGACGATCTTGGGGTCCAATCCAGAGCCTATAACGACGAGTTCTG
TTGGAGTTTTGATGTGAATTTTTTTGGAGGGACACTGTTTTGGTGCGACCTCGCTGTGGCCGGAGATGGTGGTCATATGAGTCTTTCTATGGTGGCGTTC
AAGCAAGGTAGTAAATTTATTGGGAACGGCGATGTTCGATGGTTTGCTAGGGACGATGGAGTTTATCTCGAGGTATTCCTCGATAAAAACCGCCGAGTGC
AATACTATGCAATATGGGCTCATTGGAGTTCTTGA
AA sequence
>Lus10022831 pacid=23160052 polypeptide=Lus10022831 locus=Lus10022831.g ID=Lus10022831.BGIv1.0 annot-version=v1.0
MNTLEKLKVVTLVLCTTTILVYPGPSTHQYSVHITNNLTGSRDLAVHCQSKDDDLGVQSRAYNDEFCWSFDVNFFGGTLFWCDLAVAGDGGHMSLSMVAF
KQGSKFIGNGDVRWFARDDGVYLEVFLDKNRRVQYYAIWAHWSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G06090 Plant self-incompatibility pro... Lus10022831 0 1
Lus10024141 9.8 0.7368
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 13.9 0.7368
AT2G15220 Plant basic secretory protein ... Lus10001608 17.0 0.7368
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 19.6 0.7368
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 21.9 0.7368
Lus10013255 24.0 0.7368
Lus10013259 25.9 0.7368
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10013964 27.7 0.7368
AT3G06240 F-box family protein (.1) Lus10014136 29.4 0.7368
Lus10028570 31.0 0.7368

Lus10022831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.