Lus10022835 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26880 47 / 3e-07 Plant self-incompatibility protein S1 family (.1)
AT1G04645 46 / 5e-07 Plant self-incompatibility protein S1 family (.1)
AT5G04350 45 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT2G24870 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT3G27680 42 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT3G27329 41 / 4e-05 Plant self-incompatibility protein S1 family (.1)
AT3G54925 41 / 5e-05 Plant self-incompatibility protein S1 family (.1)
AT5G12070 41 / 5e-05 Plant self-incompatibility protein S1 family (.1)
AT3G27331 40 / 5e-05 Plant self-incompatibility protein S1 family (.1)
AT3G55252 41 / 6e-05 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022831 78 / 6e-19 AT2G06090 63 / 2e-13 Plant self-incompatibility protein S1 family (.1)
Lus10018785 76 / 3e-18 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1)
Lus10000682 69 / 5e-15 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1)
Lus10000683 65 / 8e-14 AT4G16295 57 / 5e-11 S-protein homologue 1 (.1)
Lus10023196 64 / 1e-13 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1)
Lus10023194 62 / 4e-13 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1)
Lus10000558 61 / 6e-13 AT4G16295 55 / 1e-10 S-protein homologue 1 (.1)
Lus10016329 61 / 8e-13 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10023195 61 / 1e-12 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 59 / 2e-11 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 58 / 3e-11 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.010G008300 47 / 3e-07 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 42 / 3e-05 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 40 / 9e-05 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 39 / 0.0002 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 39 / 0.0002 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.018G148366 38 / 0.0004 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 38 / 0.0004 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10022835 pacid=23160040 polypeptide=Lus10022835 locus=Lus10022835.g ID=Lus10022835.BGIv1.0 annot-version=v1.0
ATGGCGACAGCAGCAGCGGTCACCTTTTTAGCGACGGCCCTAATCACGATGGCAGGTCCGTCGAGCCAGCTCACGGTACATGTTATAAATAATATGAGGT
CCACCACAAGCGCGCTGAGGGTGCATTGCCAATCGATCGACGACGATCTCAGCCTACAAATAGTCCCCGTTAACTCCGAGTTCAGTTGGAGCTTCACGCC
GGACTTTTTCCTTGGGACGCGTTATTCATGCGATCTCGCCGTGGATGATTTGATAGTCTCTTACGTCGCATTCAGCGGTCGTACCTCTCTCGGATGCGGA
GGCCATATTAACTGGTATGTTCGGGATGGTGGCGTGTTTGTGAGTAAAATATACCGCTCCTATAGAGGCTCCGTCCTGATACGCTTTTTTCTTATTGCTC
GATGGGAATATCTATAG
AA sequence
>Lus10022835 pacid=23160040 polypeptide=Lus10022835 locus=Lus10022835.g ID=Lus10022835.BGIv1.0 annot-version=v1.0
MATAAAVTFLATALITMAGPSSQLTVHVINNMRSTTSALRVHCQSIDDDLSLQIVPVNSEFSWSFTPDFFLGTRYSCDLAVDDLIVSYVAFSGRTSLGCG
GHINWYVRDGGVFVSKIYRSYRGSVLIRFFLIARWEYL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26880 Plant self-incompatibility pro... Lus10022835 0 1

Lus10022835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.