Lus10022844 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28730 176 / 1e-56 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1)
AT2G20270 166 / 9e-53 Thioredoxin superfamily protein (.1.2)
AT5G63030 95 / 3e-25 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1)
AT5G40370 89 / 3e-23 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2)
AT5G20500 85 / 3e-21 Glutaredoxin family protein (.1)
AT5G18600 78 / 4e-19 Thioredoxin superfamily protein (.1)
AT1G77370 76 / 5e-18 Glutaredoxin family protein (.1)
AT4G15700 73 / 3e-17 Thioredoxin superfamily protein (.1)
AT4G15690 71 / 3e-16 Thioredoxin superfamily protein (.1)
AT3G21460 71 / 4e-16 Glutaredoxin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011915 302 / 2e-106 AT4G28730 154 / 4e-48 glutaredoxin C5, Glutaredoxin family protein (.1)
Lus10022253 100 / 8e-28 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10013089 100 / 2e-27 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10001237 91 / 1e-23 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10021590 91 / 2e-23 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1)
Lus10017148 90 / 4e-23 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Lus10042104 87 / 2e-22 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10028355 82 / 5e-20 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1)
Lus10033965 77 / 2e-18 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G254100 182 / 5e-59 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1)
Potri.015G078900 89 / 5e-23 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.018G133400 89 / 9e-23 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Potri.012G082800 88 / 1e-22 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.001G347700 85 / 1e-21 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Potri.007G017300 75 / 2e-17 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1)
Potri.002G208700 74 / 2e-17 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1)
Potri.014G134000 72 / 9e-17 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1)
Potri.008G214800 69 / 9e-16 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
Potri.008G214500 69 / 1e-15 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10022844 pacid=23159918 polypeptide=Lus10022844 locus=Lus10022844.g ID=Lus10022844.BGIv1.0 annot-version=v1.0
ATGGCGACTGCATCTCATTTCGTCAATCTCACCTCTCGGCCTCTCAAATCCTGCCTCCCGCCATCCCTCGCCACTCTCCCCATCACCTCTTTCCCCCTCA
ACCACAGCCGCCGCCGCGCTCTTCTCACAGCCTCCGTCAATGTCTCCACAAACACACATCGACCCATCACCGTGGTCCGAGCCATGTCCGATTCTTCAGA
TTCTTCCTCTTCCTTCGGTGCCAGGCTCGAAGAGACCGTGAAGAGGACCGTGGCCGAGAACCCAGTCGTGGTTTACTCCAAGTCTTGGTGCTCGTACTCG
TCTGAGGTGAAAGGATTGTTCAAGAAGCTTGGAGTAGAGCCGTTGGTTATCGAATTGGATGAGCTTGGTGCGCAAGGGCCGCAGTTGCAGAAGATACTGG
AAAGGGTTACAGGCCAACACACTGTTCCTAATGTGTTTATAGGGGGTAATCACATTGGTGGTTGCACAGATACTTTGAAGCTCAACAGGAATGGCGAACT
CCAGTCTTTGCTCGAAAAGGCCAATGCCAAAGCCAGGCAGAGTTAG
AA sequence
>Lus10022844 pacid=23159918 polypeptide=Lus10022844 locus=Lus10022844.g ID=Lus10022844.BGIv1.0 annot-version=v1.0
MATASHFVNLTSRPLKSCLPPSLATLPITSFPLNHSRRRALLTASVNVSTNTHRPITVVRAMSDSSDSSSSFGARLEETVKRTVAENPVVVYSKSWCSYS
SEVKGLFKKLGVEPLVIELDELGAQGPQLQKILERVTGQHTVPNVFIGGNHIGGCTDTLKLNRNGELQSLLEKANAKARQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28730 GrxC5 glutaredoxin C5, Glutaredoxin ... Lus10022844 0 1
AT4G26670 Mitochondrial import inner mem... Lus10043170 1.4 0.9349
AT1G77490 TAPX thylakoidal ascorbate peroxida... Lus10018155 5.2 0.9079
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Lus10016155 6.3 0.8782
AT4G21065 Tetratricopeptide repeat (TPR)... Lus10000117 6.7 0.8973
AT5G47030 ATPase, F1 complex, delta/epsi... Lus10040130 9.2 0.9077
AT3G57560 NAGK N-acetyl-l-glutamate kinase (.... Lus10030601 14.0 0.8976
AT5G35530 Ribosomal protein S3 family pr... Lus10030502 15.4 0.9138
AT3G53630 unknown protein Lus10023752 16.6 0.9057
AT3G53630 unknown protein Lus10003983 16.7 0.9049
AT5G43790 Pentatricopeptide repeat (PPR)... Lus10039388 17.1 0.8912

Lus10022844 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.