Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47110 76 / 8e-17 Leucine-rich repeat protein kinase family protein (.1) AT5G39390 66 / 3e-13 Leucine-rich repeat protein kinase family protein (.1) AT3G47580 61 / 2e-11 Leucine-rich repeat protein kinase family protein (.1) AT3G47090 56 / 1e-09 Leucine-rich repeat protein kinase family protein (.1) AT5G20480 55 / 2e-09 EFR EF-TU receptor (.1) AT3G47570 52 / 2e-08 Leucine-rich repeat protein kinase family protein (.1) AT1G73080 50 / 1e-07 ATPEPR1, PEPR1 PEP1 receptor 1 (.1) AT1G17750 46 / 2e-06 AtPEPR2 PEP1 receptor 2 (.1) AT5G46330 43 / 3e-05 FLS2 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1) AT1G74360 42 / 4e-05 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006445 [exp] 191 / 7e-58 AT3G47570 468 / 1e-152 Leucine-rich repeat protein kinase family protein (.1) Lus10011386 [exp] 181 / 1e-53 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011388 [exp] 181 / 2e-53 AT3G47570 757 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011387 [exp] 180 / 4e-53 AT3G47570 782 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030903 [exp] 179 / 9e-53 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030847 [exp] 172 / 2e-50 AT3G47570 746 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030587 [exp] 167 / 1e-48 AT3G47570 776 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10014500 [exp] 163 / 4e-47 AT3G47570 663 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030636 [exp] 161 / 1e-46 AT3G47570 757 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G099100 [exp] 97 / 6e-24 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G102700 [exp] 94 / 4e-23 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.019G100901 [exp] 92 / 2e-22 AT5G39390 394 / 9e-133 Leucine-rich repeat protein kinase family protein (.1) Potri.018G020000 [exp] 92 / 3e-22 AT3G47570 816 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G273001 [exp] 92 / 3e-22 AT3G47570 635 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228200 [exp] 91 / 4e-22 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.012G044500 [exp] 91 / 5e-22 AT3G47570 764 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G115900 [exp] 89 / 3e-21 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G145200 [exp] 87 / 9e-21 AT3G47570 793 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.013G133100 [exp] 87 / 2e-20 AT3G47570 761 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022863 pacid=23159940 polypeptide=Lus10022863 locus=Lus10022863.g ID=Lus10022863.BGIv1.0 annot-version=v1.0 ATGGTTGCTCATGTTGGCGATTTTGGATTTACAAGATTCCTTTCAAAAATTGCAAATCCCTCTTCAAGTTCCATTGGAATAAAAGGGACGGTCGGCTATG CACCTCCAGGAAAGAGACCAACTACCAAAACTTTCAGAGACGGCTCGGGCCTTCACAATATTGTTAGAAACGCTTTGTCGAAGCAACACAAATGCGAAGT CGTGGATCCGATTCTACTCAATGAACTACTTCATAGGTTGATACGCCATCGCAACTACGACCCTAGCAGCTCCGAGGAAGCAAGAAATGAACTAGAGGAA CTAATGTGTTCCATTTGCGAAATCGGCGTTGCTTGCTCTTCAAACATCCCAAAAGAAAGGATTAACATGAGCGAAGTTTTATCAAGACTTACCGCCATAA AAAAGAAGTTCCATAGGTTACGTCATGTCGAAAGGAGATAA
AA sequence Show only first row Show all	>Lus10022863 pacid=23159940 polypeptide=Lus10022863 locus=Lus10022863.g ID=Lus10022863.BGIv1.0 annot-version=v1.0 MVAHVGDFGFTRFLSKIANPSSSSIGIKGTVGYAPPGKRPTTKTFRDGSGLHNIVRNALSKQHKCEVVDPILLNELLHRLIRHRNYDPSSSEEARNELEE LMCSICEIGVACSSNIPKERINMSEVLSRLTAIKKKFHRLRHVERR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47110			Leucine-rich repeat protein ki...		Lus10022863 [exp]	0	1
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10025891 [exp]	1.0	0.9136
AT1G77120		ADH1, ATADH, AT...	ARABIDOPSIS THALIANA ALCOHOL D...		Lus10029757 [exp]	1.4	0.8957
AT1G14720		ATXTH28, EXGT-A...	xyloglucan endotransglycosylas...		Lus10029000 [exp]	3.0	0.8938
AT4G24060	DOF	AtDof4,6	Dof-type zinc finger DNA-bindi...		Lus10003208 [exp]	3.5	0.8764
AT5G20480		EFR	EF-TU receptor (.1)		Lus10022864 [exp]	3.7	0.8675
AT4G27290			S-locus lectin protein kinase ...		Lus10037736 [exp]	5.7	0.8409
AT2G25270			unknown protein		Lus10038102 [exp]	6.9	0.8870
AT5G55180			O-Glycosyl hydrolases family 1...		Lus10029149 [exp]	8.1	0.8087
AT4G24060	DOF	AtDof4,6	Dof-type zinc finger DNA-bindi...		Lus10017313 [exp]	9.2	0.8480
AT2G33580			Protein kinase superfamily pro...		Lus10042225 [exp]	10.6	0.8303

Compare expression of checked genes

Lus10022863 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.