Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43960 361 / 2e-121 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G25150 179 / 9e-51 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G60980 156 / 1e-42 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G48650 126 / 1e-31 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT1G13730 117 / 1e-28 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT2G03640 110 / 2e-26 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain AT3G07250 77 / 1e-14 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1) AT1G69250 56 / 2e-08 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G03457 46 / 4e-05 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G55540 45 / 6e-05 nuclear transport factor 2 (NTF2) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024953 [exp] 318 / 1e-107 AT5G43960 159 / 8e-47 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10023722 [exp] 286 / 6e-91 AT5G43960 266 / 2e-83 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10014469 [exp] 183 / 4e-53 AT5G43960 156 / 4e-43 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10022765 [exp] 176 / 2e-49 AT3G25150 408 / 1e-138 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10003144 [exp] 170 / 4e-47 AT3G25150 385 / 2e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10025906 [exp] 157 / 2e-41 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10036918 [exp] 139 / 4e-36 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10037066 [exp] 136 / 5e-35 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10026668 [exp] 123 / 1e-30 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G257000 [exp] 448 / 3e-155 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.014G192900 [exp] 402 / 2e-137 AT5G43960 392 / 3e-133 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 328 / 4e-108 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 172 / 6e-48 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G246600 [exp] 169 / 1e-46 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.017G094600 [exp] 153 / 2e-41 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.008G096700 [exp] 149 / 6e-40 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.010G157800 [exp] 132 / 9e-34 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.007G095800 [exp] 45 / 4e-05 AT5G10350 285 / 3e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.015G004600 [exp] 45 / 6e-05 AT3G49430 303 / 1e-103 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10022873 pacid=23159990 polypeptide=Lus10022873 locus=Lus10022873.g ID=Lus10022873.BGIv1.0 annot-version=v1.0 ATGGCCGCTCCGTATCCGGGACCCGTCTCTGCCATTCAGGTAGGGTCGTACTTTGTTGGCCAGTATTATCAGGTGCTTCAGCAGAAGCCTGATCTTGTTC ATCAGTTCTACTCCGATTCCAGCACCATGATCCGCGTCGATGGAGATGTCAGCGAGACCGCCACGACAATGCTGCATATCCATAACATCATCATGTCCCT GAACTTTGCTGCAATCGAGATCAAGACGATCAACTCTATCGAATCGTGGAATGGGGGTGTTCTGGTGATGGTTTCTGGATCTGTTAAGACCAAGGATTTC AGTGGCAGGAAGAAGTTTGTCCATACGTTTTTCCTAGCTCCTCAGGAGACGGGTTATTTCGTTCTCAACGATATCTTCCAGTTCATTGATACCGAAGTAG TCTACCAGCAACAACCTACTTCTACTGCATCTGAAAACATCTACCCGCAGCATGCAGCTCCGAGTGCGAACGATCGCATCTACCAGGAACATCATGCTTC TAGTACGAATGACCACATCTACCAGCAGCATCAGGACCAAGTAACTTCTGAATCCTTCTATCAGCAACACGCCCCAGAGGATACACTTGAGTCCCAACTA AATGCTTCTGATAATTACGCCGAGCCTCCAGTGCAAGATACGCGTACAGAGGAGGCACCTGCATTCGAAGGTGCTGTGGATGTTGTACACGAACCCCCAA CATCTGCGGTGGAGGAACCTATTGAAGAACCATCAAAGAAAACCTGGGCTTCTATCTTGAAAGTTGCTAAGGGACCACAGGCACCGGCTGTTGCACAGCC ACCTGTGATCAAAAGTGTGCCAGCTTCTTCAGAGTGGAACCATGTATCAGTGCCTGTTGCTCAGCAGTCGGATGCAGGGTTGTCAGTTCTGCCTGAGCCT GCAAATGACGTAGCAGAAGATGGGTTTGAAGATGACGGTGAATTCAAATCTGTCTATGTTCGCAACTTGCCATCCGATATTACAGCTGCCGAAATCGAAC AGGAGTTCAGAAACTTCGGTAGAATAAGCCCTGACGGTGTCTTCGTCAGGAACCGAAAAGATGTCATTGGTGTATGTTACGCATTCGTTGAATTTGAAGA CCTTGTGAGTGTTCAGAACGCAATAAAGTCATCTCCTATTCAATTGGCGGGGAGACAAGTGTACATTGAAGAACGAAGACCAACCGGAGGCATTGCTTCC CGAGGTGGAAGAGGGGGAAGGGGAAGAGGCCGAGGTGGTTACCCAACGGAAGCCCCACGCGGCCGCTACGGCGGTGGCCGCGGTTTAGGCAGATCGAGCA ACCAAGACAATGGCGAATACAATAATCGAACGAGGGGCAATGGTTACCCTCAGCGCTCTACGCGATAG
AA sequence Show only first row Show all	>Lus10022873 pacid=23159990 polypeptide=Lus10022873 locus=Lus10022873.g ID=Lus10022873.BGIv1.0 annot-version=v1.0 MAAPYPGPVSAIQVGSYFVGQYYQVLQQKPDLVHQFYSDSSTMIRVDGDVSETATTMLHIHNIIMSLNFAAIEIKTINSIESWNGGVLVMVSGSVKTKDF SGRKKFVHTFFLAPQETGYFVLNDIFQFIDTEVVYQQQPTSTASENIYPQHAAPSANDRIYQEHHASSTNDHIYQQHQDQVTSESFYQQHAPEDTLESQL NASDNYAEPPVQDTRTEEAPAFEGAVDVVHEPPTSAVEEPIEEPSKKTWASILKVAKGPQAPAVAQPPVIKSVPASSEWNHVSVPVAQQSDAGLSVLPEP ANDVAEDGFEDDGEFKSVYVRNLPSDITAAEIEQEFRNFGRISPDGVFVRNRKDVIGVCYAFVEFEDLVSVQNAIKSSPIQLAGRQVYIEERRPTGGIAS RGGRGGRGRGRGGYPTEAPRGRYGGGRGLGRSSNQDNGEYNNRTRGNGYPQRSTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43960			Nuclear transport factor 2 (NT...		Lus10022873 [exp]	0	1
AT2G16595			Translocon-associated protein ...		Lus10012169 [exp]	1.0	0.9086
AT2G03640			Nuclear transport factor 2 (NT...		Lus10037066 [exp]	2.4	0.8965
AT3G06720		IMPA1, IMPA-1, ...	importin alpha isoform 1 (.1.2...		Lus10037722 [exp]	3.0	0.8658
AT1G56340		AtCRT1a, CRT1	calreticulin 1a (.1.2)		Lus10031410 [exp]	4.5	0.8607
AT4G27585			SPFH/Band 7/PHB domain-contain...		Lus10032909 [exp]	4.6	0.8889
AT1G32860			Glycosyl hydrolase superfamily...		Lus10033244 [exp]	4.9	0.8733
AT1G75990			PAM domain (PCI/PINT associate...		Lus10025072 [exp]	6.2	0.8404
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10004650 [exp]	8.0	0.8707
AT4G20980			Eukaryotic translation initiat...		Lus10015435 [exp]	8.9	0.8811
AT1G56340		AtCRT1a, CRT1	calreticulin 1a (.1.2)		Lus10031409 [exp]	9.2	0.8385

Compare expression of checked genes

Lus10022873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.