Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04070 86 / 5e-23 ATTOM22-I, TOM22-I translocase of outer membrane 22-I (.1) AT5G43970 85 / 1e-22 ATTOM22-V, TOM22-V, TOM9-2 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024950 [exp] 170 / 3e-56 AT5G43970 116 / 4e-35 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G257200 [exp] 112 / 1e-33 AT5G43970 98 / 5e-28 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1) Potri.014G192601 [exp] 109 / 2e-32 AT5G43970 98 / 4e-28 TRANSLOCASE OUTER MITOCHONDRIAL MEMBRANE 22-V, translocase of outer membrane 22-V (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04281 [flax] [poplar] Tom22 Mitochondrial import receptor subunit Tom22
Representative CDS sequence Show only first row Show all	>Lus10022876 pacid=23160068 polypeptide=Lus10022876 locus=Lus10022876.g ID=Lus10022876.BGIv1.0 annot-version=v1.0 ATGGCAGCTCAGTCATCCAGAGGCGGAGTCTCGCTCCCCGACAAGAGAGCTTCTTCTTCCAAGCGTAAAATGCCGGATTCCGAAACCATCCTCGCCAAGT TCAGCAACTCCCAGATCGTCTCCGTGGGTAAGCGAGTCGTCTCCGACACCGCCTACGTCACCAAGAGGCTCCTCCGCAGCACCGGGAAGGCGGCCTGGAT CGCCGGGACCACGTTCTTGGTATTGGCGGTGCCGCTGATCATCGAGATGGAACGGGAGCAGCAGTTCACCGAGCTCGAGCTCCAGCAGCAGAGCCTCCTC GGACCGCCGCCGGTTGTTGCGCCCCAGAAGTAG
AA sequence Show only first row Show all	>Lus10022876 pacid=23160068 polypeptide=Lus10022876 locus=Lus10022876.g ID=Lus10022876.BGIv1.0 annot-version=v1.0 MAAQSSRGGVSLPDKRASSSKRKMPDSETILAKFSNSQIVSVGKRVVSDTAYVTKRLLRSTGKAAWIAGTTFLVLAVPLIIEMEREQQFTELELQQQSLL GPPPVVAPQK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Lus10022876 [exp]	0	1
AT5G44500			Small nuclear ribonucleoprotei...		Lus10038421 [exp]	1.0	0.9385
AT3G49910			Translation protein SH3-like f...		Lus10028537 [exp]	3.5	0.9334
AT1G23290		RPL27A, RPL27AB	RIBOSOMAL PROTEIN L27A, Riboso...		Lus10016336 [exp]	4.2	0.9273
AT4G34880			Amidase family protein (.1)		Lus10027853 [exp]	4.5	0.8899
AT3G49910			Translation protein SH3-like f...		Lus10011540 [exp]	4.9	0.9112
AT2G32600			hydroxyproline-rich glycoprote...		Lus10021506 [exp]	5.1	0.8861
AT5G67630			P-loop containing nucleoside t...		Lus10019267 [exp]	5.3	0.9039
AT3G15000			cobalt ion binding (.1)		Lus10032619 [exp]	10.1	0.8776
AT2G40510			Ribosomal protein S26e family ...		Lus10030533 [exp]	11.0	0.9007
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Lus10004113 [exp]	11.2	0.8958

Compare expression of checked genes

Lus10022876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.