Lus10022881 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04400 271 / 1e-94 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
AT2G33370 271 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
AT1G04480 271 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
ATCG00780 67 / 9e-15 ATCG00780.1, RPL14 ribosomal protein L14 (.1)
AT1G17560 43 / 3e-05 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042695 275 / 5e-96 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1)
Lus10023730 274 / 6e-96 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1)
Lus10011773 273 / 7e-95 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10024943 272 / 1e-94 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10020499 252 / 2e-87 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1)
Lus10012464 252 / 2e-87 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10024942 215 / 5e-73 AT2G33370 214 / 1e-73 Ribosomal protein L14p/L23e family protein (.1)
Lus10022882 215 / 5e-73 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10008065 91 / 1e-24 AT1G04480 91 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G171200 274 / 5e-96 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G066400 274 / 5e-96 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.002G257500 274 / 5e-96 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.011G127250 190 / 8e-63 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G167700 162 / 3e-52 AT3G04400 160 / 9e-53 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.003G136400 159 / 7e-51 AT3G04400 157 / 2e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.004G166200 157 / 2e-50 AT3G04400 156 / 5e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G022800 44 / 8e-06 AT5G46160 199 / 3e-66 Ribosomal protein L14p/L23e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence
>Lus10022881 pacid=23160026 polypeptide=Lus10022881 locus=Lus10022881.g ID=Lus10022881.BGIv1.0 annot-version=v1.0
ATGTCGAAACGAGGTGCGACGACGACCGTAGAACTCTGTCCTACCTCTGTCACTGGATTTCCACGATTTACCATTTTCCCTTGTCTGATTTTCAACTTTG
TCTGGTTTTTTTTCTGTCTGTGTTTAGGGAGAGGAGGAAGTGCGGGGAACAAGTTTAGGATGTCCCTTGGACTTCCGGTGGCGGCGACGGTCAACTGCGC
CGACAACACCGGGGCAAAGAACTTGTACATCATCTCCGTGAAAGGAATCAAAGGTAGACTCAACAGGCTGCCTTCTGCTTGCGTCGGAGACATGGTGATG
GCCACTGTGAAAAAGGGTAAGCCTGATCTCAGGAAGAAGGTGATGCCTGCTGTCATCGTCAGGCAGCGCAAGCCATGGCGCCGAAAGGACGGTGTCTTCA
TGTACTTCGAAGATAATGCTGGTGTGATTGTGAACCCGAAGGGAGAAATGAAGGGATCTGCTATCACTGGCCCCATTGGAAAGGAGTGTGCTGATCTATG
GCCAAGAATCGCTAGTGCAGCAAATGCGATTGTCTGA
AA sequence
>Lus10022881 pacid=23160026 polypeptide=Lus10022881 locus=Lus10022881.g ID=Lus10022881.BGIv1.0 annot-version=v1.0
MSKRGATTTVELCPTSVTGFPRFTIFPCLIFNFVWFFFCLCLGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVM
ATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10022881 0 1
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Lus10032591 3.3 0.9481
AT1G63270 ABCI1, ATNAP10 ATP-binding cassette I1, non-i... Lus10022692 3.7 0.9156
AT5G24510 60S acidic ribosomal protein f... Lus10028876 4.9 0.9383
AT5G25500 unknown protein Lus10002897 5.5 0.9173
AT2G47640 Small nuclear ribonucleoprotei... Lus10026556 6.0 0.9183
AT4G16720 Ribosomal protein L23/L15e fam... Lus10000165 6.3 0.9287
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10024576 7.1 0.9238
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Lus10012057 8.1 0.9219
AT5G57280 RID2 root initiation defective 2, S... Lus10007484 8.8 0.9165
AT1G57540 unknown protein Lus10035345 10.9 0.8892

Lus10022881 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.